KEGG   Plasmodium berghei: PB000520.00.0Help
Entry
PB000520.00.0     CDS       T01111                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00895  
diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
pbe  Plasmodium berghei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB000520.00.0
   00030 Pentose phosphate pathway
    PB000520.00.0
   00051 Fructose and mannose metabolism
    PB000520.00.0
Enzymes [BR:pbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PB000520.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 1252 aa AA seqDB search
KDVKIKKLKEHGHSASLNDNLSPLQYERIKYKPTLPKALASEYQILDEDFGDEFINKKDY
EEIKKFFKSIDNLPMINVKETNNNELFKGGNVLKIGIILSGGPAPGGHNVISGIYDYAKR
YNEESQVIGFLGGIDGLYSKNYVTITDNLMNKFRNLGGFNMLWSGRGKVRNKDDLLAIEN
IVLKLKLNGLVIIGGDGSNSNAALIAEYLKERNIPISVIGVPKTIDGDLKSESIEISFGF
DTATRTYSEIIGNLCTDVKTGNNVYHVVRVMGRSASHVVLECALQTRPNIVLIGEEVEKD
KVPLKSIINNIVNIILKRHDLNKNYGVILLPEGLIEFIPEIKILIEELNVILKTSNPSEP
FDASKLKESKDLWNFLPQIIKDQLLLDRESTGYIQVGKVATERLIINLVESELAKLKNVN
LNIHFMAHYLGYEGRCALPSNFDCNYCYSLGYNAALLIDHKKTGYMSIIRNLKNSYEDWI
PAGIPFLRIMHVCKDNFGKEYPAVKKYLVDLNSPLFNVLTQVRKLWSLYDLYRSPGPIQF
NGYLSNSRCYTVKIPEKDELLCQNSDDLNIIIKSTTKGSSEKNEDNVVSGSLNNENKNNE
IQHQSGYKSLGCMSELQTSRLYNKLELPELCSDLKAKVRAGKQYISNDPYTQKQILSNYP
NMSYENKFQIQEIFHDKYATPISFEIKIGIVFLSRQSPGAMNVLCGLYRRLKLLKGVCIA
FYGLYGLLSNKYVIINDENIAKHLNQGGLELTGNSPEHSLFDEENRNKVCETVSKLQLNG
LVMPGSNVTITEAALLAEYFLEKKIHTSVVGIPLTGSNNLIHELIETCVGFDSSTKVYAS
LIGNVLTDAVSMPKYWHFIRLMGRSPSHEVLECALQTHPNMVIISEEYGAADKTLWRVVQ
DIADVVCARAELGKNYGTVLIPDALLMHLPHMKILLTEISDILNEASEKGELIQARNDLV
NLSNEKIEKESPWISKLTPWSLALIKTFPQFIIKELLHVDLRSMRFEKLETEQLLLQMVK
EELHQRKAKGKYSGVFMGLTHFFGYQGRSSLPSEFDCKLAYAYGHAASIVIESGLTGYIV
SIRGLCGNVNDWKLFAIPFISLMKILLRGQGSKSLKSASKGDLPVIPSAPVDLNGKAYRS
LKIALQKWQMEDSSCNPGPIQFEGNASNYYSRTLFEEQSEYFEMLRYVECYANILKDTCR
FGVSADYLKNVFVQLSGMLVLAYKPNDIMQNMPSIGSIEDYYDWENQRKTDK
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
aaagatgtaaaaataaaaaaattaaaagaacatgggcattcagcatccttaaatgataat
ttaagtccattacaatatgaaaggataaaatataaacccactttacctaaagccttagca
agtgaatatcaaatattagatgaggattttggagatgaatttataaataaaaaagattat
gaagaaattaaaaaattctttaaaagtatagataatttaccaatgataaatgtaaaagaa
acaaataacaatgaattatttaaaggtggaaatgtattaaaaattggtattatattatcg
ggggggccagcgccaggtggtcataacgttatatcaggtatttatgattatgcaaaaaga
tataatgaagaatctcaagttattggatttttaggaggtatagatggtttatatagtaaa
aattatgtaacaataacagataatttaatgaacaaatttagaaatttaggtggttttaat
atgttatggtccggtagaggtaaagttcgaaataaggatgatttactagctattgaaaat
attgttttaaaattaaaattaaatggtttagtaattataggaggtgatggttcaaatagt
aatgcagcattaattgcagaatatcttaaagaaagaaatattcctatttcagttataggt
gttcccaaaacaattgatggtgatttaaaaagtgaatctattgaaataagttttggattt
gatacagcaactagaacctattcagaaataataggaaatttatgtacagatgtaaaaaca
ggaaataatgtttatcatgttgttagggttatgggtcgatctgcttcacatgttgtgtta
gaatgtgcattacaaacaagaccaaatattgtgttaattggtgaagaagttgaaaaagat
aaagtaccattgaaatctattataaataatattgttaatattatattaaaacgacatgat
ttaaataaaaattatggtgttattttgttaccagaagggttaatagaatttataccagaa
ataaaaatattaatagaggaattaaatgttattttaaaaacatcgaatccatctgaacca
tttgatgcatctaagttaaaagaatctaaagatctttggaattttttaccacaaataatt
aaggatcaattattattagatagagaatcaactggttatatacaagttggaaaagtagca
actgaaagattaataataaatttagtcgaatctgaattagctaaattaaaaaatgttaat
ttaaatatacattttatggctcattatttaggatatgaaggtagatgtgcattaccatca
aattttgattgcaactattgttattcgttaggatataatgctgcattattaattgatcat
aaaaaaactggttatatgtcaataatacgaaatctaaaaaattcatatgaagattggata
cctgctggtattccatttttaagaataatgcatgtatgtaaagacaattttggaaaagaa
tatcctgccgtaaaaaaatatttagtagatttaaatagtccattatttaacgttttaaca
caagttcgaaaattatggtctttatacgatttatatagatcccctgggccaatacaattt
aatggctatttaagcaattcaagatgttatactgttaagatacctgaaaaagatgaatta
ttatgtcaaaactctgacgatttaaatataattattaaatcaacaactaaaggaagtagt
gaaaaaaatgaggataatgtggtttctggaagtttaaacaatgaaaataaaaataatgaa
atacaacatcaatcaggatataaatctcttggctgcatgtcagagttacaaacatcacgt
ttatacaataaattagaattacccgaattatgttcagatttaaaagcaaaagtgagagca
ggaaaacaatatatatcaaatgatccatatactcaaaaacaaatattatcaaattatcca
aacatgtcttatgaaaataagtttcaaattcaagaaatatttcatgataaatatgcaaca
cctatatcctttgaaataaaaataggaattgtatttctatcgaggcagtcgccaggtgct
atgaatgtattatgtggcttgtatagacgactaaaattattaaaaggtgtgtgcatagca
ttttatggattatatggattattaagtaataaatatgtaataataaatgatgaaaatata
gctaaacatttaaatcaaggaggtttagaattaacaggaaattcaccagaacattcatta
tttgatgaagagaatagaaataaagtttgtgaaacagtatctaagttacagttgaatggc
ttagtaatgccgggttcaaatgtgacaataacagaagcagcattattagctgaatacttt
ttagaaaaaaaaattcatacatctgttgttggaataccattaacgggttctaacaattta
attcatgaattaattgaaacatgtgttggttttgatagtagtactaaagtttatgcatct
ttaattggtaatgtccttacagatgctgttagtatgccaaagtattggcattttattcga
ttaatggggcgctctccatcgcatgaagtgttagaatgtgcattacaaacacaccccaat
atggtgataatatcagaagaatatggagcagctgataaaacattatggagagttgttcaa
gatatagctgatgtagtatgtgctagagcagaactaggaaaaaattatggaacagttcta
attccagatgcattattaatgcatctaccacatatgaaaatattattaacagaaataagt
gatatattaaatgaagcatctgaaaaaggagaattaatacaagcaagaaatgatttagtt
aatttatcaaatgaaaaaattgaaaaagaatcaccatggatatctaaattaacaccatgg
agtttggcattgattaagacattcccacaatttataattaaagaattattacatgttgat
ttaagatctatgcgttttgaaaagttagaaacagaacaattattattgcaaatggttaaa
gaagaattacatcaaagaaaagcgaaaggaaaatattcaggagtatttatgggattaact
catttttttggttaccaagggcgttcctcattaccttccgaatttgattgtaaattagca
tatgcatatgggcatgcagcttcaattgttatagaaagtggattaactggttatattgta
tcaattagaggtttatgtggtaatgttaatgattggaaattatttgcaattccatttatt
tcacttatgaaaatattattaagaggtcaaggaagcaaatcattaaaaagtgcatctaaa
ggggacctcccagttattcctagtgcacctgttgatttaaatggaaaagcctatagaagt
ttaaaaattgctttacaaaaatggcaaatggaagacagttcttgtaatcctggccccata
caatttgaagggaatgcatctaattattacagtaggacattatttgaagaacaatctgaa
tattttgaaatgttaagatatgtagaatgttatgcaaatatattaaaagatacatgtcga
tttggtgtatctgctgactatttaaaaaatgtatttgttcaattatctggtatgcttgtt
ttagcatataaaccaaatgacataatgcaaaacatgccttctataggaagtattgaggat
tactatgattgggaaaatcaaagaaaaactgataaataa

DBGET integrated database retrieval system