KEGG   Plasmodium berghei: PB000521.01.0Help
Entry
PB000521.01.0     CDS       T01111                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pbe  Plasmodium berghei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PB000521.01.0
Enzymes [BR:pbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PB000521.01.0
Peptidases [BR:pbe01002]
 Cysteine Peptidases
  Family C44
   PB000521.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 547 aa AA seqDB search
WNGIVVEENGDGTTNVLTHERLSIVDVLSGQQPLYDDKKEICLTINGEIYNHLELRKLVK
QDILDALKSKSDCAIIPNLYKIYKEKLPCMLDGIFAGVISDKKYNTFFAFRDPIGICPLY
IGYAADGSIWFASEFKALRIYCVRYVAFPPGHYYMCNNGKGEFVRYYNPNWWKLNSPIPN
NKIDLEKIRITLENAVIKRLMGDVPFGVLLSGGLDSSIIASIISRHLKSIQTGTINNING
ACVGKNNKNLNALKSFSIGLKDSPDLKAAKEVSDFLNTDHTEFHFTVDQGIDTLHDVIYH
IETYDITTIRASTPMYILSRLIKSSCIKMVLSGEGSDEIFGGYLYFHKAPNAEEFHRELQ
RKIHDLHIYDVLRANKSTMAFGIEARVPFLDLEFLDLVMNIDPKEKMCSNNRIEKDILRR
AFSGYLPDHILYRQKEQFSDGVGYNWIDGLKEYAEKKVSDAQFSRAPFLFPYNTPKTKEA
YLYRCIFYQCFPEQCAQEFVPEGPSIACSTSKAIEWDEQFKVNPDQSGRYVLDVHKHSKN
IEDIKAA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
tggaatggtatagttgtcgaagaaaatggagatggaacaacaaatgtattaactcatgaa
agattatcaattgtagatgtattatcaggacaacaaccattatatgatgataaaaaagaa
atatgtttaactattaatggagaaatatataatcatttagaattaagaaaattagtaaaa
caagatattttagacgcattaaaaagtaaatcagattgtgctataattccaaacttatat
aaaatatataaagaaaaattgccttgtatgttagatggtatatttgcgggagttattagt
gataaaaaatataatacattttttgcatttagagatcctataggaatatgcccactttat
ataggttatgcagcagatggttcaatatggtttgcatctgaatttaaagcgttaaggata
tactgcgttagatatgtagcatttccacctggccattattacatgtgtaataatggaaaa
ggtgaatttgttagatattataatccaaactggtggaaattgaatagccctatacccaat
aataaaattgacttagaaaaaatacgtattactttagaaaatgcagtaattaaaagatta
atgggtgatgtaccgtttggagttttattatctggtggtttagattcatctataattgca
tctataatttcaagacatttaaaatcaatacaaactggcactattaataatattaacgga
gcatgtgttggaaaaaataataaaaatttaaatgctttaaaaagcttttctattggatta
aaagattctcctgatttaaaagcagctaaagaagtttcagattttttaaacacagatcat
acagaatttcattttactgttgaccagggtattgatacattacatgatgttatataccac
attgaaacatatgatataacaactatccgtgcatctacacctatgtatattctttcaagg
ttaataaaaagcagttgtattaaaatggttttaagtggggaaggatcggatgaaatattt
gggggatatttatatttccataaggcaccaaatgcagaagaattccatagagaattacaa
aggaaaatacatgatttacatatttatgatgttttacgagcaaataaatctactatggct
tttggtatagaagcacgtgtaccctttttagatttagaatttttagacttagttatgaat
atagatccaaaagaaaaaatgtgttcaaataatagaattgaaaaagatattttaagaaga
gctttttctggttatttacctgatcatatcctttacagacaaaaggaacaattttccgat
ggtgttggttataattggattgatggattaaaagaatatgcagaaaaaaaagtatcagat
gctcaattttctagagctcctttcctttttccatataatacaccaaaaactaaagaagct
tatttatatcgatgtatattttatcaatgttttcctgagcaatgtgctcaagaatttgta
cccgaaggtccatctatagcttgctctacaagcaaggcaattgaatgggatgaacagttc
aaagtaaatcctgaccaatcaggtagatatgttttagacgtacacaagcattcaaaaaat
attgaagatataaaagccgcctaa

DBGET integrated database retrieval system