KEGG   Plasmodium berghei: PB000532.02.0Help
Entry
PB000532.02.0     CDS       T01111                                 

Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pbe  Plasmodium berghei
Brite
Enzymes [BR:pbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PB000532.02.0
Protein kinases [BR:pbe01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PB000532.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
GSFGRVILATYKNEDLPPVAIKRFEKSKIIKQKQVDHVFSERKILNYISHPFCVNLYGSF
KDESYLYLVLEFVIGGEFFTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPE
NLLLDKDGFIKMTDFGFAKVVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYE
ILVGYPPFYANEPLLIYQKILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQS
VKEHPWFSNIEWNNLLNKRVDVPYKPKYKNIFDASNFEKVQEDLSIADKVINENDPFFDW
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gggtcattcgggagagtgattttagcaacatataaaaatgaagacttacctccagttgca
attaaacgatttgaaaaaagcaaaataataaaacaaaaacaagttgatcatgtattttct
gaaagaaaaatattaaattatataagtcacccattttgtgttaatttatatggatcattt
aaggatgaatcttatttatatttggttcttgaatttgtaattggaggtgaattttttaca
tttttgagaagaaataaaagatttccaaatgatgtagggtgtttctatgcagcacaaatt
gttttaatatttgaatatttgcagagtttaaatattgtatacagagacttaaagcccgag
aacttgcttctggataaagatggatttataaaaatgactgattttggttttgcaaaagtt
gtaaacacacgaacatacaccttatgcggaacacctgaatatatagccccagaaatatta
ttaaatgctggccatggaaaagcggtggattggtggacattgggaatctttatatatgaa
attttagttggatatcctcctttttatgcaaatgaacctttattaatatatcagaaaatt
ttagaaggaattatttatttccctaaatttttagataataattgtaagcatttaatgaaa
aaactattatctcatgatcttacaaaaagatatggaaatttaaaaaaaggtgctcaaagt
gttaaagaacatccatggttttctaatattgaatggaataatttattaaataaaagagtt
gatgttccatataaacctaaatataaaaatatattcgatgcatctaattttgaaaaagtt
caagaagatttatctatagcagataaagttattaatgaaaatgatccattttttgattgg
tag

DBGET integrated database retrieval system