KEGG   Plasmodium berghei: PB000532.02.0Help
Entry
PB000532.02.0     CDS       T01111                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit
Organism
pbe  Plasmodium berghei
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
GSFGRVILATYKNEDLPPVAIKRFEKSKIIKQKQVDHVFSERKILNYISHPFCVNLYGSF
KDESYLYLVLEFVIGGEFFTFLRRNKRFPNDVGCFYAAQIVLIFEYLQSLNIVYRDLKPE
NLLLDKDGFIKMTDFGFAKVVNTRTYTLCGTPEYIAPEILLNAGHGKAVDWWTLGIFIYE
ILVGYPPFYANEPLLIYQKILEGIIYFPKFLDNNCKHLMKKLLSHDLTKRYGNLKKGAQS
VKEHPWFSNIEWNNLLNKRVDVPYKPKYKNIFDASNFEKVQEDLSIADKVINENDPFFDW
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gggtcattcgggagagtgattttagcaacatataaaaatgaagacttacctccagttgca
attaaacgatttgaaaaaagcaaaataataaaacaaaaacaagttgatcatgtattttct
gaaagaaaaatattaaattatataagtcacccattttgtgttaatttatatggatcattt
aaggatgaatcttatttatatttggttcttgaatttgtaattggaggtgaattttttaca
tttttgagaagaaataaaagatttccaaatgatgtagggtgtttctatgcagcacaaatt
gttttaatatttgaatatttgcagagtttaaatattgtatacagagacttaaagcccgag
aacttgcttctggataaagatggatttataaaaatgactgattttggttttgcaaaagtt
gtaaacacacgaacatacaccttatgcggaacacctgaatatatagccccagaaatatta
ttaaatgctggccatggaaaagcggtggattggtggacattgggaatctttatatatgaa
attttagttggatatcctcctttttatgcaaatgaacctttattaatatatcagaaaatt
ttagaaggaattatttatttccctaaatttttagataataattgtaagcatttaatgaaa
aaactattatctcatgatcttacaaaaagatatggaaatttaaaaaaaggtgctcaaagt
gttaaagaacatccatggttttctaatattgaatggaataatttattaaataaaagagtt
gatgttccatataaacctaaatataaaaatatattcgatgcatctaattttgaaaaagtt
caagaagatttatctatagcagataaagttattaatgaaaatgatccattttttgattgg
tag

DBGET integrated database retrieval system