KEGG   Plasmodium berghei: PB000542.01.0Help
Entry
PB000542.01.0     CDS       T01111                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pbe  Plasmodium berghei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pbe00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 396 aa AA seqDB search
NSSNLIEDDKSIEDLYNENISSQNALKKFSKDINGNIYIDTNRRERRIKINKHLLALYNN
NNIKASNFIYPLFIHEEDIEKKETKLEGIYTFNFEGIVKEIEECLKLNIHHFMFFPVVRE
ENKSVYCEECYNENSYFCKTITKIKDKFLNDVIIYVDIALDPYNVYGHDGIYDNKNQEII
NDISVHTLVKQSLCLAKSGADVLCPSDSMDNRIGLIRKNLDYCNFRNVLILSYTCKYAST
LYKPFRYILSANISKNFIKNKQSYQHNFNNYIDLNNVDKHIKEGADIIMVKPSLFYLDII
REIKKRIGENINVPIAVYNVSGEYMMIKSYVKYLNENENYENEILTELFKSYLRAGANII
ITYFAKQYGLYIKNLYEKKIHIEDNNSNNFNVELTL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
aattccagcaatttaattgaagatgataaatcaattgaagatttatataacgaaaacatc
tcaagtcaaaacgccttaaaaaaattctccaaagatataaatggcaacatatatattgat
acaaataggcgtgaaaggcggataaaaataaataaacatttgctcgcattatataataat
aataatataaaggcatcaaatttcatttatccattattcatccatgaagaggatatcgaa
aaaaaagaaacaaagttagaaggaatatatacatttaactttgaaggaatagtaaaggaa
atagaagaatgtttaaaattaaacatccaccattttatgttttttccagttgtaagagaa
gaaaataaatctgtatattgcgaagaatgctataatgagaatagttatttttgtaaaacg
ataactaaaataaaagacaaatttttaaatgatgttataatttatgttgacatagctcta
gatccttataatgtttatggtcatgatggtatatatgataataaaaaccaagaaattata
aatgatataagtgtgcatacccttgttaagcagtctctttgtttggcgaaatctggagct
gatgttttatgcccaagtgattcaatggataatagaattggacttattagaaaaaatttg
gattattgtaatttcagaaatgttttaattttatcatacacgtgtaaatacgcatcaacc
ctttataagccatttagatatattttaagtgctaatatatcaaaaaactttattaaaaac
aaacagtcatatcaacacaattttaacaattacattgatcttaacaatgtagataaacat
ataaaagaaggagcagatattataatggtcaaaccgtccttgttttacttagatattata
agagaaataaaaaaaaggattggggaaaatataaatgttcccatagctgtttataatgtt
tctggagaatatatgatgattaaaagttatgtaaaatatttgaatgaaaatgaaaattat
gaaaatgaaattcttacagagttattcaaaagttatttgagagctggagcaaatataatt
attacatattttgctaagcaatatggattatatatcaaaaatttatatgaaaaaaaaatt
cacattgaagataataatagcaataattttaatgtagaactaactttataa

DBGET integrated database retrieval system