KEGG   Plasmodium berghei: PB000639.00.0Help
Entry
PB000639.00.0     CDS       T01111                                 

Definition
eukaryotic translation initiation factor 3 subunit
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pbe  Plasmodium berghei
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PB000639.00.0
Translation factors [BR:pbe03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PB000639.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 715 aa AA seqDB search
MVKVEESELSDKELVDFLSDDSDDGNETLLNKKYAGKEALITLETKFPKIVTILGIPKVE
EEKHSRLAEVLKKLFIRHLSAKISDSSIMNIKIYMPVDDEKKTKGICFVTFHDSFQANEA
VKVLNKLKLDAKHLLTASKMDDIENIINRDERVMPINVVGFTREKIRWWLYDEKCREQFI
VRYDSHFEVHWLDPLEKEPQIYTTFKKNAPFSSVQWSNQGSYLVSFHNPGIALWGGDNFE
KLIRLQHKSVKDISFSPNENYVLTWDGTPASLRNEKSICIWRVITGKLLRSFITPEYSPR
EKIFPHFLWGPDDKYIACIGKQKEVYIYELPSMLLLEDHEKKRTPLKYSMVKEFDWSPVD
NIVAIWIPETNNTPGTLILVEIPSRKELVSRKIYDVSQASIHWQSKGDYLCLKTTIVKKI
GKKGKKEYTQLEIFRMREKNIPVDNIQIEGVKTKQFHWEESNSNRFALIVRDEATSRQQI
RFYKILNKGTTRNVKWTSTFDINNQMNFMKWSPQGTFFILASLLSEGMLYFCFLNSNDQV
EVIHKDEHLLVNSVAWSNCGRYLVTSVSNLSGISSSNYKEENSETGFYVWTFQGRCLMTV
KKPSFYQFFFRPHPKSLFSDKLKIDIKNNLKDYSKKFDVIDEKIRNSKKNQLISERQNVE
NSFNEKLEKITRLFQSFKEYELFRRNWETFESQFEWEEKTVVIEHVLSVKQEIFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggttgaagaaagtgaattaagcgacaaggagcttgtcgattttttatcagat
gatagtgatgatgggaatgaaactttgttaaataaaaaatatgcaggaaaagaagccttg
attaccctcgaaacaaagttccctaaaatagttacaatattgggtataccaaaagtagaa
gaagaaaaacatagtagattagcagaagttttaaagaaattatttataaggcatttaagt
gctaaaataagtgactcttcaataatgaatataaaaatctatatgcctgtagatgacgaa
aaaaaaacaaaaggaatatgttttgttacatttcatgacagttttcaagcaaatgaagca
gtaaaagtattaaataaattaaaattggatgcaaaacatttattaacagcatcaaaaatg
gatgatatagaaaatataataaatagagatgaacgcgtaatgcctataaatgttgttgga
ttcacaagagaaaaaataagatggtggttatatgatgaaaaatgccgagagcaatttatt
gttaggtacgatagtcattttgaagttcattggttagatcccttagaaaaagaaccacaa
atttatactacctttaaaaaaaatgccccattttcaagcgttcaatggagtaatcaagga
tcatacttagtcagttttcataacccaggtatagcattatggggtggagataattttgaa
aaattaataagattacagcataaaagtgtcaaagatataagtttttcaccaaatgaaaat
tatgtactaacttgggatggtactcctgcttcattaagaaatgaaaaatctatttgtata
tggagagtaataacaggaaaattgcttcgatcttttattacacctgaatatagtccacga
gaaaaaatatttcctcattttttatggggccctgatgataaatatattgcatgtatagga
aaacaaaaagaggtatatatatatgaattaccatctatgttattattagaagatcatgag
aaaaaaagaaccccattaaaatattcgatggttaaagaatttgattggtctcctgtagat
aatatagttgcaatttggatacctgaaacaaataacacaccagggactttaatattagta
gaaattccatctagaaaagaactagtatctcgaaaaatttatgatgttagtcaggcatct
attcattggcaaagcaaaggagattatttatgtcttaaaacaactattgtaaaaaaaatt
ggaaaaaaaggaaaaaaagaatacacacaattagaaattttcagaatgcgagaaaaaaat
atacctgtagataatatacaaattgaaggagtaaaaactaaacaatttcattgggaagaa
tcaaatagtaataggtttgcattaatagtaagagatgaagctacaagtagacaacaaata
agattttataaaatattaaataaaggtactactagaaatgttaaatggactagtacattt
gatataaataaccaaatgaattttatgaaatggtcaccacaaggaaccttttttatatta
gcatcattattatcagaaggaatgctatatttctgttttttaaattcaaacgatcaagtt
gaagttatacataaagatgaacatttattagtaaattctgttgcatggagcaattgtggt
agataccttgttacatctgtttcgaatttatctggtatatcaagttctaactataaagaa
gaaaatagtgaaacaggtttttatgtatggacatttcaaggtagatgtttaatgactgtt
aaaaaaccatcattttatcaatttttctttcgacctcatccaaaatcattatttagtgat
aaattgaaaattgatataaaaaataatctaaaagattattctaaaaaattcgatgttata
gatgaaaaaattagaaattctaaaaagaaccaattaatttcagaaaggcaaaatgttgaa
aattcatttaatgaaaaattggagaaaatcacaagattattccaatcctttaaagagtat
gaattgttcaggagaaattgggaaacatttgaaagccaatttgagtgggaagaaaaaaca
gttgttattgaacatgtcctttctgttaaacaagaaatcttcgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system