KEGG   Plasmodium berghei: PB000659.00.0Help
Entry
PB000659.00.0     CDS       T01111                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pbe  Plasmodium berghei
Brite
Enzymes [BR:pbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PB000659.00.0
Protein kinases [BR:pbe01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PB000659.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 523 aa AA seqDB search
MLKKKKEYSGIEKEEKNTKKKNNASECLSMQNDDSTYIDSNEEDKSWEYINENTNENIKN
NDDINKKSGEKEYNASETKKTNNNEKNKNNSNNKTSKINDEKINIKEAIIKNVHVPDNYI
IKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIR
LYDLIIPDDLLKFDELYIVLEIADSDLKKLFKTPIFLTEEHIKTILYNLLLGENFIHESG
IIHRDLKPANCLLNQDCSVKVCDFGLARTINSEKDTNIVNDLEENEEPGPHNKNLKKQLT
SHVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHINDPTNRFPLFPGSSCF
PLSPDRNSKKVHEKSNRDQLNIIFNIIGTPTEDDLKNINKPEVIKYIKLFPHRKPINLKQ
KYPSISDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKKLENFSTKKIILPFDDWM
VLSETQLRYIFLKEVQSFHPELVIPSVFTIHENNFYNNEKPSS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaaaaaaaagaatactctggaattgaaaaagaggaaaaaaatacaaaaaaa
aaaaacaatgcttcagaatgtttaagcatgcaaaatgatgatagcacatatatagatagc
aatgaagaagataaaagttgggaatacataaatgagaacacaaatgaaaatataaaaaat
aacgacgatattaacaaaaaatctggcgaaaaagaatacaatgcatccgagacaaaaaaa
accaataataacgagaaaaacaaaaataatagtaacaataaaactagcaaaataaatgat
gaaaaaataaatataaaagaagctattataaaaaatgtgcatgtgccagataattacata
attaagcacttaataggaagagggtcgtatgggtatgtatatttagcttatgataaaaat
acagaaaaaaatgttgcaataaaaaaggtaaatcgaatgtttgaagatttaattgattgt
aaaagaatattaagagaaataacaattttgaatagactaaaaagtgattatattataaga
ttatatgatttaataatacctgatgatttattaaaatttgacgaattgtatatagtatta
gaaatagccgattcggacttaaaaaaattatttaaaaccccaatatttttgacagaagaa
catataaaaactatattatataatttattattaggtgaaaattttattcacgaatcaggt
attatccatagagatttaaaaccagctaactgtttattaaatcaagattgctctgttaaa
gtatgtgattttggtttagctagaacgataaatagtgaaaaagatactaatatagtaaat
gatttagaagaaaatgaagaaccagggccacataataaaaatttaaaaaaacaattaact
agccatgtagttactagatggtatagagcccctgaattaatcctgttacaagaaaattat
actaaatctatagatatatggtctactggttgtatttttgcagaactattaaatatgtta
caaagccatattaatgatcccactaatagatttcctttatttccaggatcttcttgtttt
ccactatctccagaccgtaattcaaaaaaagtacatgagaaaagtaatagagaccaatta
aatattatttttaatatcataggtacacctacagaagatgatcttaaaaatattaacaaa
cccgaagttataaaatatattaaattattcccgcacagaaaacctataaatctaaagcaa
aaatacccatctatttcagatgatggaataaatttattagaatcaatgttaaaatttaat
ccaaataaacgaatcacaattgaccaggctttagatcatccttatctaaaagatgttaga
aaaaaaaaattagaaaatttctcaacaaaaaaaattattcttccttttgatgattggatg
gttttatctgaaacacaattgagatatatatttttaaaagaagtgcaatcctttcatcct
gaattagttataccttctgtatttactatacacgaaaacaatttctataacaatgagaaa
cctagcagttaa

DBGET integrated database retrieval system