KEGG   Plasmodium berghei: PB000726.02.0Help
Entry
PB000726.02.0     CDS       T01111                                 

Definition
cGMP-dependent protein kinase 1, beta isozyme
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pbe  Plasmodium berghei
Brite
Enzymes [BR:pbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PB000726.02.0
Protein kinases [BR:pbe01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PB000726.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 841 aa AA seqDB search
NERNKKKAILSHEDFTGEDSLMENHLELRDKLTEDIVTIKASLKNNLVCSTLNENEILAL
SNYMQFFVFKSGDMVIKQGEKGSYFFIINSGKFDVYVNDKKVKTLTKGSSFGEAALIHNT
QRSATIKAGTNGTLWGVQRSTFRATLKQLSNRNFNENRSFIDSVSVFDMLTEAQKNMITN
ACVIQNFKPGETIVKQGDYGDVLYIKDGKATVYINDEEIRVLEKGSYFGERALLYDEPRS
ATIIAKEVTSCASICRKLLNVVLGNLQVVLFRNIMTEALQQSEIFKQISPDQLNDLADTA
IVRDYPANYNILHKDKIKSVKYIIVLEGKVELFLDDESIGILTRGKSFGDQYVLNQKQKF
KHTLKSLEVCKIALITESCLADCLGNNNIDASIDYNNKKSIIKKMYIFRYLTDKQCNLLI
EAFKTTRYEEGDYIIQEGEVGSRFYIIKAGEVEIVKNNKRLRTLGKNDYFGERALIYDEP
RTASVISTVNNLECWYVDKSVFLQIIEGPMLAHLEERIKMQDTKVEMSELLTERIIGRGT
FGIVKLVLHEPTKIRYALKCVSKKSIIELNQQNNIKLEREITAENDHPFIIRLVRTFKDS
KYFYFLTELVTGGELYDAIRKLGLLSRSQAQFYLGSIILAIEYLHERSIVYRDLKPENIL
LDKQGYVKLIDFGCAKKIHGRSYTLVGTPHYMAPEVILGKGYGCTVDIWAFGVCLYEFIC
GPLPFGNDQEDQLEIFRDILTGQLTFPDYVTDTDSINLIKRLLCRLPQGRIGCSINGFKD
IKENSFFADFDWDRLAGRLLEPPLISKSETYAEDIDVKQIEQEEEDNANTEIDDENWDID
F
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
aatgaaagaaataaaaaaaaggcaattttatctcatgaggatttcacaggggaggatagt
ttaatggagaaccatttagaattgagggataaattgacagaagatatcgtcactataaaa
gcatccctaaaaaataatcttgtatgcagtacactaaatgaaaatgaaatattagcactg
tctaattatatgcagttttttgttttcaaaagtggggatatggtcataaaacaaggagaa
aaaggttcctactttttcattataaatagtggaaaatttgatgtatacgtaaatgacaaa
aaagtgaaaactttgaccaaaggtagctcatttggggaagctgctttaatacacaatact
caaagaagtgctactataaaagcaggaacaaatggaacgctatggggtgtacaaagaagt
acattcagagcaacactaaagcaattatccaatagaaattttaatgaaaatagaagcttt
attgattctgtatctgtttttgatatgctaacagaagcacaaaaaaatatgataaccaat
gcatgcgttatacaaaattttaaacccggagaaacaatagttaaacaaggggattatgga
gatgttctatatattaaagacggaaaagcaaccgtatatattaatgacgaagaaatcaga
gttctagaaaagggatcgtacttcggagagagagctcttctgtatgatgaaccacgaagt
gctacaattatcgctaaggaagtaacatcttgtgcatctatttgtcgaaaattgctaaat
gtggttctggggaatttacaagtagtattgtttcgtaacattatgacagaggctcttcaa
cagagcgaaatatttaaacaaataagtccagatcaattaaatgatttagctgatacagct
atagttagagattacccagcaaattataatatattacataaagataaaataaaaagtgta
aaatatataatagtattagaaggtaaagtagagttatttcttgatgatgaatcgattgga
atattgacaagaggtaaatcatttggagatcaatacgtacttaatcaaaaacaaaaattt
aagcatacattaaaatcgttagaggtatgcaaaatagcattaattacagaatcgtgctta
gccgattgcttaggaaataataatatagatgcatctatagattataataataaaaaaagt
atcataaaaaagatgtatatttttcgatatttaactgataaacagtgtaatttacttatc
gaagcatttaaaacaactcgatatgaagaaggagattatattatacaagaaggtgaggta
gggtcacgattttatataatcaaagctggagaagtagaaatagtaaaaaataataaaaga
ttaagaacattagggaaaaatgattactttggcgaaagggcattaatttatgatgaacca
agaacagcatcagttataagcactgtaaataatttagaatgttggtatgttgataaatct
gtttttttacaaattattgaaggacccatgttagcacatttggaagagagaattaaaatg
caagatactaaagtagagatgtcagaattattaacagaaagaataatagggagaggtaca
tttggtattgttaagctagttttacacgaacccacaaaaattagatatgcattaaaatgc
gttagtaaaaaaagtattatagaattaaaccaacaaaataatatcaaattagaaagagaa
attactgctgaaaatgaccatccatttattattaggctagtaagaaccttcaaagattct
aaatatttttattttttaacggagttagttactggaggagaactttatgatgctattaga
aagttaggtctattatcaagatcacaagcacagttttatctaggctctattatattagca
atcgaatatttacatgaaaggagtatagtgtatcgagatttaaaacctgaaaacatctta
ttagataagcaagggtatgttaaattaatcgattttgggtgtgcaaaaaaaatacatgga
agatcatatacattagttggaacaccacattatatggcccctgaagttatattaggaaaa
ggatatgggtgcacagttgatatatgggcattcggtgtttgcttatatgaatttatatgt
ggtccattaccctttggtaatgatcaagaagatcaattagaaatatttagagacatatta
acagggcagttaaccttcccagattatgttactgatactgatagtattaatttaattaaa
agattattatgtagattaccccaaggaagaatcggttgctcaataaatggattcaaagat
attaaagaaaattcattttttgccgattttgattgggacagactagctggacgtttgctt
gaacctcctctcatttcgaaaagcgaaacttatgcagaggatatcgatgttaaacagatc
gaacaagaagaggaagataatgcaaataccgaaattgatgatgaaaattgggatattgat
ttttaa

DBGET integrated database retrieval system