KEGG   Plasmodium berghei: PB000769.02.0Help
Entry
PB000769.02.0     CDS       T01111                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pbe  Plasmodium berghei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PB000769.02.0
Enzymes [BR:pbe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PB000769.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 118 aa AA seqDB search
NSINNKNCDDENNNILKKNNKIIKGERIDKNNNENSNLIIKNLEKQTDQISINILNILKA
SNIPNCDILKRTNKRFAKAFLYLTEGYNMNVKNIIKKSIYKRKYKNNTLIKIKDIHVY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
aattcgataaataataaaaattgtgatgatgaaaataataatattttgaaaaaaaataat
aaaataataaaaggtgaaagaatagacaaaaacaataatgagaatagtaatttaattata
aagaatttagaaaaacaaacagatcaaataagtataaatatattaaacattttaaaagca
tcaaatattccaaattgtgatatattaaaaagaacaaataaaagatttgctaaagcattt
ttatatttaactgaagggtataatatgaatgtaaaaaatataataaaaaaatctatatat
aaaagaaaatataaaaataacacattaattaaaataaaagatatacatgtttat

DBGET integrated database retrieval system