KEGG   Plasmodium berghei: PB000787.03.0Help
Entry
PB000787.03.0     CDS       T01111                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pbe  Plasmodium berghei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbe01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pbe00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 351 aa AA seqDB search
MHSGLLTNHKDEKNIYVNKCISIVGSPLSAGQSLSGVNKACDNLRKFGLHDVIKAVGWGY
EDIGNIGEKIPINGFLKQENIEKENDQINNNNPSYYNNIKNAEVIGKFSEKLFQTMSSEL
KKKNFILNIGGDHGVAFSSILSMLQTYNNLKVIWIDAHGDINIPETSPSGNYHGMSLAHA
LGLFKKKVPYFEWSEKLLHLKPENVAIIGIRDIDKYEKIILKKCNINYYTMFDIDKKGIY
NIICEALNKIDPNKNSPIHISLDIDSVDSIYAPGTGTIAKGGLNYREIHLLIKSISDTKR
VVSMDIVEYNPLLDESDKAVHGDSLPIDPNATKTGKLCLELIARVLGNDIV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaggattattaacaaatcataaagatgaaaagaacatttatgttaacaaatgt
atatcaatagttggctccccattatctgctggtcaatcccttagcggtgtaaataaggct
tgtgataatttgagaaaattcggattacatgatgttattaaagcagtaggctgggggtat
gaagatattggaaatattggagaaaaaataccaatcaatggttttttaaaacaagaaaat
attgaaaaggaaaatgaccaaataaataacaataatccaagctactataataatataaaa
aacgcagaagttatcggtaaatttagtgaaaaattattccaaaccatgagttcagaatta
aaaaaaaaaaattttattttaaatattggaggcgatcatggggttgctttttcaagcata
ttaagcatgttgcaaacatataataatttaaaggttatatggatagatgcacatggggat
ataaatatacccgaaacgtcaccttctggaaattatcatggaatgtcattagcacatgct
ttaggcttgtttaaaaaaaaagttccatattttgaatggtcagaaaaattattacattta
aaaccagaaaatgtagctattattggaataagagatatagataaatatgaaaaaattatt
ttaaaaaaatgtaatataaattactatactatgtttgatatagataaaaaaggtatttac
aatattatttgtgaagctttaaataaaatcgatccaaataaaaattcccctatacatata
tcactggatattgatagtgttgattcgatatacgcgcctggaactggtacaatagctaaa
ggtggattgaattatagggaaattcatttattaatcaaatctatatcagatactaaacga
gttgtatctatggacattgttgaatataacccccttttggatgaaagtgataaagctgtg
catggagattctttaccaattgatccaaatgctacaaaaactggaaaattatgtcttgag
cttattgccagagttctaggcaatgatatagtttaa

DBGET integrated database retrieval system