KEGG   Plasmodium berghei: PB000806.03.0Help
Entry
PB000806.03.0     CDS       T01111                                 

Definition
mitogen-activated protein kinase 1
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pbe  Plasmodium berghei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MEREKQKKTQKNVSKQLHTKSNKNETDNIDEHVLKKYDIIKKIGKGAYGIVFKARCRKYK
KIVAVKKIFGAFQNSTDAQRTFREIMFLHQLNGHDNIIKLLDVMRAKNDQDIYLVFEYME
TDLHEVIRADILEEVHKKYIIYQLLRALKYMHSGLLLHRDIKPSNILLNSECHLKICDFG
LARSISTEVNENKIPVLTDYVATRWYRAPDILLGSTNYTEGVDMWSLGCIMAELLLGKPL
FRGNSTMNQLEKIIEIVGKPNKKDIEDIKSPYAETIISSFADTGKKKKKFSEIFHKASQD
SIDLLEKLLQFNPTKRITAEMALKHKYVENFHLLIEEPICKHIITIPVDESTKYKVDFYR
NIIYYNILKRKKI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggagagagaaaaacagaagaaaactcaaaaaaatgtgtctaaacagttgcataccaaa
tcgaataagaatgaaacagataatattgatgaacatgttctaaaaaaatatgatataata
aaaaaaattggaaagggagcatatggtatagtattcaaagcacggtgtagaaaatataaa
aaaattgtagcagtaaaaaaaatatttggagcatttcaaaattctacagatgctcaaaga
acatttcgagaaatcatgtttttacatcaattaaatggacatgataatataattaaacta
ttggacgtaatgagagccaaaaatgatcaagacatttatttggtgtttgaatatatggaa
acagatttacatgaagttataagagcagatatattagaagaagttcataaaaaatatata
atatatcaattgttaagagcattgaaatatatgcactcaggtttattattgcatagagat
attaagccatcaaatatattattaaattcagaatgccatttaaaaatatgtgattttgga
ttggcgcgaagtatatcaacagaagtcaatgaaaataaaataccagtattaacagattat
gtagcaacacgttggtatagagctcctgatattttattaggaagcacaaattatacagaa
ggtgtcgatatgtggtcgcttgggtgcattatggccgaattattattaggaaagccatta
tttagaggtaattcaactatgaaccaactagaaaaaattattgaaatagttggaaaacca
aataaaaaagatattgaagatataaaatcaccatatgctgaaactattatatcttctttt
gctgatactggaaaaaaaaaaaaaaaattttcagaaatttttcataaagcatcccaagat
tctatagatttacttgaaaaactattacaatttaatccaacaaaaagaataacagcagaa
atggcgcttaaacataaatatgtagaaaactttcatcttttaatagaggaaccaatttgc
aaacatattattacaataccagttgatgaaagtacaaaatataaagttgatttttatcga
aatattatatattacaatattttaaaaaggaaaaaaatt

DBGET integrated database retrieval system