KEGG   Plasmodium berghei: PB000847.02.0Help
Entry
PB000847.02.0     CDS       T01111                                 

Definition
cytochrome c2 precursor
Orthology
K08738  
cytochrome c
Organism
pbe  Plasmodium berghei
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PB000847.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 152 aa AA seqDB search
MNLFKNKKDIYNDDFQANFVLPPGDKVKGEKLFKKHCKQCHSIAPDNQSNSGFTSWGPSL
FNVYNRTAGMSKGNSPFQVSPDMETSGIIWNDVNLMRYMKNPKQFVEANIGMNFKGIANF
QDRVDIVHYLKTITYDDPHGQEIIKKYSNKSK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttaaaaataaaaaggatatatataatgatgattttcaagccaattttgta
ttgcccccgggagacaaagtcaaaggtgaaaaactattcaaaaaacattgtaagcaatgc
cattcaatagcaccagataatcaatctaattcgggatttaccagttgggggccttcttta
tttaatgtatataatagaacagcggggatgagcaaagggaattcgccatttcaagtttca
ccagatatggaaacatccggaattatatggaatgatgtaaatctaatgagatatatgaaa
aatccaaaacaatttgttgaggcaaatattggtatgaacttcaaaggaattgcaaatttt
caagatagagttgacattgttcattatttaaaaacgataacttatgatgaccctcatggg
caagaaataataaaaaaatattccaataaatcgaaataa

DBGET integrated database retrieval system