KEGG   Plasmodium berghei: PB000857.02.0Help
Entry
PB000857.02.0     CDS       T01111                                 

Definition
(RefSeq) translation initiation factor E4
  KO
K03259  
translation initiation factor 4E
Organism
pbe  Plasmodium berghei
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PB000857.02.0
Messenger RNA biogenesis [BR:pbe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     PB000857.02.0
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PB000857.02.0
Translation factors [BR:pbe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PB000857.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 227 aa AA seqDB search
MKYLTFNKSSKDAFDLNEKIEATKIDLSNPLLLQYNWVIWEQVSDNKIKQSNNYKDYTRP
LAKFNSVQKFWQLWNRLPQPSDLLAQRSMTRFSDDGIFRIVDALMIFRDNIQPMWEDPAN
AGGGHFEYKILPKDFPYSQIDEFWNNLVLAIIGCSLKHYDLITGIRLVDKLSTTRYGYIR
IEIWYTTITDENVRNHLRKDLEEHMCNRIDGSHVYPPRVKSLSHVHK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctaacttttaataagagtagcaaagatgcatttgatttaaatgaaaaaatt
gaagcaacgaagattgatttatcaaatcccttattgttacaatataattgggtaatatgg
gaacaagtttctgataataaaattaaacaaagtaataattataaggattatacaagacca
ttagcaaaatttaatagcgttcaaaaattttggcaattatggaatagattaccacagcca
agtgatttacttgcacaaagaagtatgaccagattctcagatgatggaatatttcgtatt
gtggatgctcttatgatttttagagataatattcaaccaatgtgggaagatccagccaat
gctggagggggacattttgaatataagatattaccaaaagattttccatatagtcaaata
gatgaattttggaataatcttgttcttgcaattattggttgtagtttaaaacattatgac
ttaataacaggaattaggttagtggataaattaagtaccacccgctatggttatataaga
atagaaatatggtataccacaataacagacgaaaatgttagaaatcatttaagaaaagac
cttgaagaacacatgtgtaatcgtatagatggttctcatgtttatcccccaagagttaaa
agtcttagtcacgtacataagtaa

DBGET integrated database retrieval system