KEGG   Plasmodium berghei: PB000860.02.0Help
Entry
PB000860.02.0     CDS       T01111                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbe  Plasmodium berghei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB000860.02.0
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PB000860.02.0
  Amino acid metabolism
   00310 Lysine degradation
    PB000860.02.0
Enzymes [BR:pbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PB000860.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
KQLIYNGNNVKRAFFNVEFRQLVNNYITCKRHFSIDTLKVPRLGDSITEGVINEWKKKVG
DYVYSDETLAVIDTDKVSVDINSKSSGALYKIFAEAGDTVLVDSPLCEIDTSAQPNENDI
KKNVEVNYEKKLEVNEEIKHINNDEDIKAKETNIGTKNKNDNTFNNESNYGGLSSYQYNN
ERTEKRIRMLPMRKRIAERLKESQNTCALLTTFNECDMSKAIVLRTELKDIFQKKYGCKL
GFVSLFLYASALALKKMPQVNAYIDNDEIVYKNYIDISVAVATPNGLTVPVIRDCQNKNL
PQLELALSDIAGKAKNNKLSLDDFTGGTFTISNGGVFGSMLSTPIINMPQSAILGMHTIK
NRPVVVNNEIVIRPVMYLALTYDHRLLDGREAVQFLCAIKDYIENPNLMLIDC
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
aagcaactgatttataacgggaataacgtcaagagagctttttttaatgtggaatttaga
caacttgtaaataattatataacatgtaaaaggcatttttctatagacacgttaaaagtg
cccagattgggtgattcaattactgaaggtgttataaatgagtggaaaaaaaaggttggt
gattacgtatattcagatgagacattagcagttattgatacagacaaagtaagtgttgat
ataaattcaaaatcgtcaggagcattatataaaatatttgctgaagcgggcgacacagtt
ttagtcgattctcctttatgtgaaattgacacttcggcacaaccaaatgaaaatgatata
aagaaaaacgtcgaagtaaattatgaaaaaaaattagaagttaatgaggaaataaaacat
ataaataatgatgaagatataaaagctaaagaaactaatataggcacaaaaaataaaaat
gacaacacatttaacaatgaaagtaattatggaggattgtcatcatatcaatataataat
gaaaggactgaaaaacgaattcgtatgctaccgatgagaaaaagaattgcagaaagatta
aaggaatcacaaaatacatgtgctttattaacaacatttaatgaatgtgatatgagtaaa
gcaatagttttaagaactgaattaaaagatatttttcaaaaaaaatatggatgtaaatta
gggtttgtatcattatttttatatgcatcagcattagccttaaaaaaaatgccacaagtt
aatgcatatatagataatgatgaaattgtttataaaaattatatagacatatcagtagct
gtagctacacctaatggtttaactgttccagttattcgagattgccaaaataaaaatttg
ccacaattagaattagctttatcagatatagctggaaaagctaaaaataataaactatca
ttagatgattttacaggaggtacatttacaatatcaaacggtggagtatttggtagtatg
ttaagtacccctattattaatatgccacaatcagccatattaggtatgcacacaataaaa
aataggccagtagttgttaataatgaaattgttattaggcctgttatgtatttagcctta
acttatgatcatagattattggatggaagagaagccgtacaatttttatgtgcaataaag
gattatatcgaaaatccaaatcttatgttaatagactgctaa

DBGET integrated database retrieval system