KEGG   Plasmodium berghei: PB000912.01.0Help
Entry
PB000912.01.0     CDS       T01111                                 

Definition
stearoyl-CoA desaturase (acyl-CoA desaturase, faty acid desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pbe  Plasmodium berghei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pbe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pbe01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 925 aa AA seqDB search
MAIWSVLDENDWNVKYVVIIYISYIVGLASCYFLRKICSQSFVNFIKLLKGVLVSIISVM
SLKYLNINTRVGVNLLHIYNIVQVCSFLEVFSIRIKNTNNKLSNDQTSIVNKYELDNENV
DHHTLIGDASQHLEKITKTILNDKKSLEENKGILKEKELIEQIEQEEKKEEEYMKAKNVS
NSKKRNSGSKINLVWIYVLFSKTFNVIYFSLFWKLIPNLIIVKIFLTLQLCTSLIYTAKN
VYKSNSNIKLLQKLLDGLNIVYYIFISLFFTKILYTFDDNYNNNLIQNFAVVSIVFHMYY
GYMAFVKYIYDYYKQFRPSLFSFILFFHIFSIIGIIKLYHHEHRKSLLIQCITFYLINGF
GITFGAHRLWSHRAFKASTFVQVLFLILNSFANQGSVIIWAKNHRLHHKYSDTKYDPHNI
RNGFFYSHVGWLLYQKTKFVKEKEKEIYVDDLLQNPILILQHKLDPYFNFFFCFIIPGIY
TYYMYNNFWDGFLILGALRWIITLHATWSINSASHSFGHRYNADIKASNNIFTSIVALGE
GCHNYHHVFPYCYAMNENFYILSINPTKYVIQLFYYLGLVWDLKSAQNICKEVRLRESLK
IEQRNKRLSENIKNQILKKEDTSYITDLMNSFKAFCNDYINISTFMYILYFLRDITIMFT
IFLMHIWYCYNKYGNGATFSKLSLESNKLFNIILFTLFHIILYALPMGTMFISLYSLVYE
CKRGLIFKNQFLNNLFGSIISSFILLPYSSEKSRKSLLTSLNEDFFKVLKGPIYFDLYII
IFSLVSVLYGFIAYGFGYFYFCTFFLVPYIVFNAWLLLYIYLLKNPPCLNAQMHTKDVDI
NILNYVAFQSLLEWKKNNSIYQSKKRLYKFIFSFINFMHHHLCYTYVVEFINSKIPSYRT
KEIYKYFDKTLDQYYFMRNDKFMEI
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggctatttggagtgtgttagacgaaaatgattggaatgttaaatatgtagtaataata
tatatatcatatattgttggtttggcttcttgctattttttgagaaaaatatgttctcaa
tcttttgttaattttataaaacttttaaaaggcgttttagtttcaataatttctgtgatg
agcttgaaatatttaaacataaataccagagtaggtgttaatttacttcacatatataat
attgtgcaggtgtgtagttttttagaagtatttagcataagaattaaaaacacaaataac
aaattgtcaaacgatcaaacttcaattgttaataaatatgagttagataatgaaaatgta
gaccaccacacattaataggggacgcatcacaacatttagaaaaaataacaaagaccatt
ttgaatgataaaaaatccttagaggaaaataaaggaatattaaaagaaaaggaacttata
gaacaaattgaacaagaagaaaaaaaagaagaagaatatatgaaagcaaaaaatgttagt
aattccaaaaaaagaaatagtggaagtaaaataaatttagtttggatttatgttttattt
tcaaaaacattcaatgtaatatatttttctttattttggaagttaatacccaatttgata
atagtaaaaatatttttgaccttacagttatgtacaagcttgatttatactgctaaaaat
gtttacaaaagcaattcaaatataaaattattacaaaaattattagatggacttaatatt
gtatattatatttttataagtttattttttacaaagatattatatacatttgatgacaat
tataataataatttaatacaaaacttcgcagtcgtttctattgtctttcatatgtattat
ggatacatggcatttgttaaatatatttatgattattataagcaattcagaccatcatta
ttttcatttatattgttttttcatatattttccataattggaataatcaaattatatcac
catgaacaccgaaaatccttgttaatacagtgcataacattttacctcattaacggattt
ggaataacattcggtgcccatcgattgtggtcacatagagcatttaaagctagtacattc
gtacaagttttatttctaattttgaatagttttgcaaatcaaggtagtgtaataatatgg
gcaaagaatcatcgtttacatcacaaatacagtgatacaaaatatgatcctcataatata
agaaatggttttttttatagtcatgttggatggttattatatcaaaaaacaaaatttgta
aaggaaaaagaaaaagaaatttatgtcgacgatttattacaaaatccaattcttatatta
caacataaattagatccatatttcaacttttttttttgcttcataataccaggtatatat
acctactatatgtataacaatttttgggatgggtttttaattttaggcgctcttagatgg
attattaccttacatgctacttggtcaattaacagtgcttctcattcatttggccataga
tataatgctgatataaaagcttctaacaatatttttacatcaatagtagctcttggagag
ggatgtcataattatcatcacgtatttccatattgttatgctatgaatgaaaatttttat
attcttagcataaaccccacaaaatatgtaatacaacttttttattatttgggattagta
tgggatttgaaatcagcacaaaatatatgtaaagaggttcgattaagagaatcattaaaa
atagaacaaagaaataaaaggttaagcgaaaatattaaaaatcaaatattgaaaaaagaa
gacacaagctatataacagatttaatgaattcctttaaagcattttgtaacgattatata
aatatttctacatttatgtatatattatactttttaagagacattactattatgtttact
atttttttaatgcacatatggtattgttataataaatatggaaatggagcaaccttttca
aaattatcactagaaagtaataaactttttaatattattttgtttacactttttcatata
attctatatgccttacccatgggaacgatgtttataagcctctattcattagtttatgaa
tgcaaaaggggattaatctttaaaaatcaattccttaacaacttatttggtagtataata
tcatcttttattttattaccatattcctctgaaaagtcaagaaaatccttattaacatca
ctaaatgaagatttttttaaagttttaaaagggccaatatactttgatttatatataatt
attttttctttagtatcagtattatatggatttattgcttacggatttgggtatttttat
ttttgcacctttttcttagtaccatatatagtttttaatgcatggttattactttatatt
tatttgttaaagaatccgccatgcttaaatgcccagatgcatacaaaggacgtagatata
aatattttaaattatgttgcttttcagtcattattagaatggaaaaaaaataattcaatt
taccaaagcaagaaaagattatataaatttattttctcctttatcaattttatgcatcat
catttatgttatacgtatgttgtggaatttataaattcaaaaataccaagctatcgaaca
aaggaaatttacaagtactttgacaaaactttagaccaatactattttatgcgtaatgac
aagttcatggaaata

DBGET integrated database retrieval system