KEGG   Plasmodium berghei: PB000912.01.0Help
Entry
PB000912.01.0     CDS       T01111                                 

Definition
stearoyl-CoA desaturase (acyl-CoA desaturase, faty acid desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pbe  Plasmodium berghei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PB000912.01.0
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PB000912.01.0
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PB000912.01.0
Lipid biosynthesis proteins [BR:pbe01004]
 Desaturase
  First
   PB000912.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 925 aa AA seqDB search
MAIWSVLDENDWNVKYVVIIYISYIVGLASCYFLRKICSQSFVNFIKLLKGVLVSIISVM
SLKYLNINTRVGVNLLHIYNIVQVCSFLEVFSIRIKNTNNKLSNDQTSIVNKYELDNENV
DHHTLIGDASQHLEKITKTILNDKKSLEENKGILKEKELIEQIEQEEKKEEEYMKAKNVS
NSKKRNSGSKINLVWIYVLFSKTFNVIYFSLFWKLIPNLIIVKIFLTLQLCTSLIYTAKN
VYKSNSNIKLLQKLLDGLNIVYYIFISLFFTKILYTFDDNYNNNLIQNFAVVSIVFHMYY
GYMAFVKYIYDYYKQFRPSLFSFILFFHIFSIIGIIKLYHHEHRKSLLIQCITFYLINGF
GITFGAHRLWSHRAFKASTFVQVLFLILNSFANQGSVIIWAKNHRLHHKYSDTKYDPHNI
RNGFFYSHVGWLLYQKTKFVKEKEKEIYVDDLLQNPILILQHKLDPYFNFFFCFIIPGIY
TYYMYNNFWDGFLILGALRWIITLHATWSINSASHSFGHRYNADIKASNNIFTSIVALGE
GCHNYHHVFPYCYAMNENFYILSINPTKYVIQLFYYLGLVWDLKSAQNICKEVRLRESLK
IEQRNKRLSENIKNQILKKEDTSYITDLMNSFKAFCNDYINISTFMYILYFLRDITIMFT
IFLMHIWYCYNKYGNGATFSKLSLESNKLFNIILFTLFHIILYALPMGTMFISLYSLVYE
CKRGLIFKNQFLNNLFGSIISSFILLPYSSEKSRKSLLTSLNEDFFKVLKGPIYFDLYII
IFSLVSVLYGFIAYGFGYFYFCTFFLVPYIVFNAWLLLYIYLLKNPPCLNAQMHTKDVDI
NILNYVAFQSLLEWKKNNSIYQSKKRLYKFIFSFINFMHHHLCYTYVVEFINSKIPSYRT
KEIYKYFDKTLDQYYFMRNDKFMEI
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggctatttggagtgtgttagacgaaaatgattggaatgttaaatatgtagtaataata
tatatatcatatattgttggtttggcttcttgctattttttgagaaaaatatgttctcaa
tcttttgttaattttataaaacttttaaaaggcgttttagtttcaataatttctgtgatg
agcttgaaatatttaaacataaataccagagtaggtgttaatttacttcacatatataat
attgtgcaggtgtgtagttttttagaagtatttagcataagaattaaaaacacaaataac
aaattgtcaaacgatcaaacttcaattgttaataaatatgagttagataatgaaaatgta
gaccaccacacattaataggggacgcatcacaacatttagaaaaaataacaaagaccatt
ttgaatgataaaaaatccttagaggaaaataaaggaatattaaaagaaaaggaacttata
gaacaaattgaacaagaagaaaaaaaagaagaagaatatatgaaagcaaaaaatgttagt
aattccaaaaaaagaaatagtggaagtaaaataaatttagtttggatttatgttttattt
tcaaaaacattcaatgtaatatatttttctttattttggaagttaatacccaatttgata
atagtaaaaatatttttgaccttacagttatgtacaagcttgatttatactgctaaaaat
gtttacaaaagcaattcaaatataaaattattacaaaaattattagatggacttaatatt
gtatattatatttttataagtttattttttacaaagatattatatacatttgatgacaat
tataataataatttaatacaaaacttcgcagtcgtttctattgtctttcatatgtattat
ggatacatggcatttgttaaatatatttatgattattataagcaattcagaccatcatta
ttttcatttatattgttttttcatatattttccataattggaataatcaaattatatcac
catgaacaccgaaaatccttgttaatacagtgcataacattttacctcattaacggattt
ggaataacattcggtgcccatcgattgtggtcacatagagcatttaaagctagtacattc
gtacaagttttatttctaattttgaatagttttgcaaatcaaggtagtgtaataatatgg
gcaaagaatcatcgtttacatcacaaatacagtgatacaaaatatgatcctcataatata
agaaatggttttttttatagtcatgttggatggttattatatcaaaaaacaaaatttgta
aaggaaaaagaaaaagaaatttatgtcgacgatttattacaaaatccaattcttatatta
caacataaattagatccatatttcaacttttttttttgcttcataataccaggtatatat
acctactatatgtataacaatttttgggatgggtttttaattttaggcgctcttagatgg
attattaccttacatgctacttggtcaattaacagtgcttctcattcatttggccataga
tataatgctgatataaaagcttctaacaatatttttacatcaatagtagctcttggagag
ggatgtcataattatcatcacgtatttccatattgttatgctatgaatgaaaatttttat
attcttagcataaaccccacaaaatatgtaatacaacttttttattatttgggattagta
tgggatttgaaatcagcacaaaatatatgtaaagaggttcgattaagagaatcattaaaa
atagaacaaagaaataaaaggttaagcgaaaatattaaaaatcaaatattgaaaaaagaa
gacacaagctatataacagatttaatgaattcctttaaagcattttgtaacgattatata
aatatttctacatttatgtatatattatactttttaagagacattactattatgtttact
atttttttaatgcacatatggtattgttataataaatatggaaatggagcaaccttttca
aaattatcactagaaagtaataaactttttaatattattttgtttacactttttcatata
attctatatgccttacccatgggaacgatgtttataagcctctattcattagtttatgaa
tgcaaaaggggattaatctttaaaaatcaattccttaacaacttatttggtagtataata
tcatcttttattttattaccatattcctctgaaaagtcaagaaaatccttattaacatca
ctaaatgaagatttttttaaagttttaaaagggccaatatactttgatttatatataatt
attttttctttagtatcagtattatatggatttattgcttacggatttgggtatttttat
ttttgcacctttttcttagtaccatatatagtttttaatgcatggttattactttatatt
tatttgttaaagaatccgccatgcttaaatgcccagatgcatacaaaggacgtagatata
aatattttaaattatgttgcttttcagtcattattagaatggaaaaaaaataattcaatt
taccaaagcaagaaaagattatataaatttattttctcctttatcaattttatgcatcat
catttatgttatacgtatgttgtggaatttataaattcaaaaataccaagctatcgaaca
aaggaaatttacaagtactttgacaaaactttagaccaatactattttatgcgtaatgac
aagttcatggaaata

DBGET integrated database retrieval system