KEGG   Plasmodium berghei: PB000920.01.0Help
Entry
PB000920.01.0     CDS       T01111                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
pbe  Plasmodium berghei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 611 aa AA seqDB search
YESGKNTSYDSLINNKIFIEDCDNEVNTRTRLLKEYENGNGISFILYPEKAIEILEKHFQ
FNLKIPRSVYQHKTKRKDKVIFKVDIQPLKVVVYSKDTNEHSNPPQMKIVILRNDTIENV
LKEIISDFDPKKFKKHLFYAEDPGENKETNWKCLYISNSNDYPLDKKVYEYDIDQMSCLL
ITNERADIKCLTYGNEYSEYNMTSNNISGSVDDDIINNSKSISYIFENGGDRGLINLGNT
CFLNSSLQCLSKILKFTNYFLSGSFWDHINYCNPVGQHGRLAKAYYETLLEMWKINKKGK
PYAPKALKQAISEKRDEFYGYQQHDSQELLAFLLDGLHEDLNLIQKKPYYEEKLQGGLDR
PDIEVAEASWKRHKEINNSIIVDLFQGQYRSRLQCPQCNKLSITFDPFMYLSIPLPPKKN
HRIWFHVMLSRNVQMSLRFSSIFSGSQEVLKLKYNFINIIKDLKKKRNSILLHTKNIIKN
NKYSHENTNAFNFHTKFMDEASESYETNNEENIGNSMNNKNNIDGSNYMRALKNKSKIKN
TLNEEDINNIYENICHMCNINTIGDIEISNLFFLYTRFKNLACNNFFQILNNNDIIAEPH
ARTGKGISHIF
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
tatgaatctgggaaaaatacatcctatgatagcttgataaataataaaatatttatagaa
gattgtgataacgaagtcaatacaagaactcgacttttaaaagaatatgaaaatggaaat
ggcataagttttattttatatcctgaaaaagctattgagatattggaaaaacatttccag
tttaatctaaaaataccaagatcagtttatcaacataaaacgaaaagaaaagataaagta
atttttaaagtcgatatccaaccacttaaagttgttgtttattcaaaagatacaaatgag
cactcaaacccccctcaaatgaaaatcgttattttacgcaacgatactatagaaaatgtt
ctaaaagagataatcagtgattttgatcccaaaaaattcaaaaaacatttattttatgcg
gaagatcctggggaaaacaaagaaacaaactggaagtgtttatacataagtaatagcaat
gattatcctttggataaaaaagtctatgaatatgatatagaccaaatgagttgtttatta
ataaccaatgaaagggctgatataaaatgcttaacatatggtaatgaatatagtgaatat
aatatgacaagcaataatatatcaggaagtgtagatgatgatataataaataattccaaa
tctattagctatatatttgaaaatggtggtgatagaggattaataaatttaggtaacaca
tgttttttaaattcatcattacaatgcttatcaaaaattttaaaatttacaaattatttt
ttaagtggatcattctgggatcatataaattattgtaatccagttgggcaacatggacga
ctagctaaagcatattatgaaacattattagaaatgtggaaaataaataaaaaaggaaaa
ccatatgctcctaaagctttaaaacaggcaataagtgaaaagagagatgaattttatgga
tatcaacaacatgattcacaagaacttttagcatttttattagatggtcttcatgaagat
ttaaatttaattcagaaaaagccatattatgaagaaaaattacaaggagggctcgatagg
ccagatatagaagttgcagaagcttcatggaaaagacataaagaaattaataattcaata
attgtcgatttatttcaaggacaatatagatcaagattacaatgcccacaatgtaacaaa
cttagtataacatttgatccttttatgtatttatcaattccgttgccacctaaaaagaat
cataggatatggttccatgttatgttaagtagaaatgttcaaatgtctttgagattttcc
tctatttttagtggttcccaagaagtgttaaaattaaaatacaattttataaacattata
aaagatttaaaaaaaaaaagaaactctatacttttacatacaaaaaatatcataaaaaat
aacaaatattcccacgaaaatacgaatgcttttaactttcataccaaatttatggatgaa
gcaagtgaaagttatgaaacaaataatgaagaaaatattgggaatagtatgaataataaa
aataatattgatggaagtaattatatgagagccttaaaaaataaatcaaaaatcaaaaat
acattaaatgaagaagacataaacaatatatatgaaaatatttgtcatatgtgtaatatt
aacacaataggtgatattgaaatttctaatttattttttttatatacgagatttaaaaat
ttagcatgcaataatttttttcaaatattaaataataatgatattatagctgaaccacat
gcaaggacagggaaaggtataagtcatatattt

DBGET integrated database retrieval system