KEGG   Plasmodium berghei: PB000928.01.0Help
Entry
PB000928.01.0     CDS       T01111                                 

Definition
triosephophate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbe  Plasmodium berghei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB000928.01.0
   01230 Biosynthesis of amino acids
    PB000928.01.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB000928.01.0
   00051 Fructose and mannose metabolism
    PB000928.01.0
   00562 Inositol phosphate metabolism
    PB000928.01.0
Enzymes [BR:pbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PB000928.01.0
Exosome [BR:pbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PB000928.01.0
  Exosomal proteins of bladder cancer cells
   PB000928.01.0
  Exosomal proteins of melanoma cells
   PB000928.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 207 aa AA seqDB search
RKKIIIANWKCYLLKEEAYQLIDKLTQIKFSNYIDVIVSPNLLFLPYLHEKIKKNDSKIS
PCSQDVSLVNGLGAFTGETTASLLHEFGINYTIIGHSERKKSFFNVGENIEQTALKVYNA
INSKLKVILCVGENYTSRECSFPFQKFRELLSLIKQKIPKEEIKNIVIAFEPRFAVGTGN
PVSSSNLNNCCFGIRRAIFDEIDESTS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
aggaaaaaaattatcatagctaactggaaatgttatttgttaaaagaagaagcatatcaa
ctaatcgacaaattaacacaaattaaattttcaaattatattgatgtaattgtatcccca
aatttattatttttaccttatcttcatgaaaaaataaagaaaaacgattcaaaaatatcc
ccttgttctcaagatgtaagtttagtaaatggtttaggggcgtttacaggggaaacaaca
gcaagtttgctacatgaatttggaataaattatacaataataggacatagtgaaagaaaa
aagagtttttttaatgttggtgaaaacattgaacaaactgcattgaaagtatataatgca
attaattccaagttaaaagttattttatgtgtaggagaaaattacacaagtagggaatgc
agtttcccctttcaaaaatttagggaattgctttctctaattaagcaaaaaatcccaaaa
gaagaaattaaaaatattgttatagcctttgagcccagatttgctgtaggaactgggaac
cctgtctcatcgtccaatctaaacaattgttgttttggtataagaagagcgatattcgat
gaaattgatgaaagtacaagc

DBGET integrated database retrieval system