KEGG   Plasmodium berghei: PB000928.01.0Help
Entry
PB000928.01.0     CDS       T01111                                 

Definition
triosephophate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbe  Plasmodium berghei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pbe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbe01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbe00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pbe00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pbe00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 207 aa AA seqDB search
RKKIIIANWKCYLLKEEAYQLIDKLTQIKFSNYIDVIVSPNLLFLPYLHEKIKKNDSKIS
PCSQDVSLVNGLGAFTGETTASLLHEFGINYTIIGHSERKKSFFNVGENIEQTALKVYNA
INSKLKVILCVGENYTSRECSFPFQKFRELLSLIKQKIPKEEIKNIVIAFEPRFAVGTGN
PVSSSNLNNCCFGIRRAIFDEIDESTS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
aggaaaaaaattatcatagctaactggaaatgttatttgttaaaagaagaagcatatcaa
ctaatcgacaaattaacacaaattaaattttcaaattatattgatgtaattgtatcccca
aatttattatttttaccttatcttcatgaaaaaataaagaaaaacgattcaaaaatatcc
ccttgttctcaagatgtaagtttagtaaatggtttaggggcgtttacaggggaaacaaca
gcaagtttgctacatgaatttggaataaattatacaataataggacatagtgaaagaaaa
aagagtttttttaatgttggtgaaaacattgaacaaactgcattgaaagtatataatgca
attaattccaagttaaaagttattttatgtgtaggagaaaattacacaagtagggaatgc
agtttcccctttcaaaaatttagggaattgctttctctaattaagcaaaaaatcccaaaa
gaagaaattaaaaatattgttatagcctttgagcccagatttgctgtaggaactgggaac
cctgtctcatcgtccaatctaaacaattgttgttttggtataagaagagcgatattcgat
gaaattgatgaaagtacaagc

DBGET integrated database retrieval system