KEGG   Plasmodium berghei: PB000928.01.0Help
Entry
PB000928.01.0     CDS       T01111                                 

Definition
(RefSeq) triosephophate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbe  Plasmodium berghei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB000928.01.0
   01230 Biosynthesis of amino acids
    PB000928.01.0
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB000928.01.0
   00051 Fructose and mannose metabolism
    PB000928.01.0
   00562 Inositol phosphate metabolism
    PB000928.01.0
Enzymes [BR:pbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PB000928.01.0
Exosome [BR:pbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PB000928.01.0
  Exosomal proteins of bladder cancer cells
   PB000928.01.0
  Exosomal proteins of melanoma cells
   PB000928.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 207 aa AA seqDB search
RKKIIIANWKCYLLKEEAYQLIDKLTQIKFSNYIDVIVSPNLLFLPYLHEKIKKNDSKIS
PCSQDVSLVNGLGAFTGETTASLLHEFGINYTIIGHSERKKSFFNVGENIEQTALKVYNA
INSKLKVILCVGENYTSRECSFPFQKFRELLSLIKQKIPKEEIKNIVIAFEPRFAVGTGN
PVSSSNLNNCCFGIRRAIFDEIDESTS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
aggaaaaaaattatcatagctaactggaaatgttatttgttaaaagaagaagcatatcaa
ctaatcgacaaattaacacaaattaaattttcaaattatattgatgtaattgtatcccca
aatttattatttttaccttatcttcatgaaaaaataaagaaaaacgattcaaaaatatcc
ccttgttctcaagatgtaagtttagtaaatggtttaggggcgtttacaggggaaacaaca
gcaagtttgctacatgaatttggaataaattatacaataataggacatagtgaaagaaaa
aagagtttttttaatgttggtgaaaacattgaacaaactgcattgaaagtatataatgca
attaattccaagttaaaagttattttatgtgtaggagaaaattacacaagtagggaatgc
agtttcccctttcaaaaatttagggaattgctttctctaattaagcaaaaaatcccaaaa
gaagaaattaaaaatattgttatagcctttgagcccagatttgctgtaggaactgggaac
cctgtctcatcgtccaatctaaacaattgttgttttggtataagaagagcgatattcgat
gaaattgatgaaagtacaagc

DBGET integrated database retrieval system