KEGG   Plasmodium berghei: PB000937.01.0Help
Entry
PB000937.01.0     CDS       T01111                                 

Definition
NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pbe  Plasmodium berghei
Brite
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PB000937.01.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 684 aa AA seqDB search
GTGEQLAKELCHNLQEIFDIKADIVDLEYFNKEEIKTLGIRIFIVSTYGNGDPPDNAIEF
FKWLKELDINNTYFRNTKYSIMGLGSKQYSHFNKIAKKLTAYLKNFKAEQISETIYGDDD
DNIYHDFEIWKNNFFKELSKILNMSHIPINFIKEEVIKLVDWKNIPDIKFDLKFENIEDD
KKSETKCHASNLLKDNTNHQEAQFNKHVSTSLTGKFYFNHNTGTVISNTNLLKNVDDSTN
SDKVNHIIISAKNIKYKSADTLVVLTKNSKQITDWWLKRLNINEIDKNKKFIFVERNDQN
SQKNSQKYDNTPYLNGTNNEKNDILINKNNDNNNNNNNNNSMHIPFPTPCTIEEALQCYC
DLSTIPRVNVLKNFKCFIKDIEELKMFNYILSNNKRNTFFNICKEFEMTFIEFVDIFMQS
AIFELTPFLQLIPKISPKSYTISSSPKDDPDMITLTVKKKQYPIHSLRKALKSFKNNNML
PNITEKKLRNLCERRWYKGSSSYYLTEELYPNDIVKFNVKTSIFTLPENLGDASIIMIAT
GTGIAPFKAFLTEFKLFDQKREKNEILNKKSQRILFYGCRKKGIDFLYEKEIMDSLENKY
IDEIYLAFSRDQSNKIYVQDLIREQKELVCNLIQKGAYVYICGNTEMGKDVKQTIVNLYE
NNKQNDKKIIKKLKKSGRFFEEIW
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
ggaacaggggaacagttggcaaaagagttatgtcacaatttacaggaaatatttgacata
aaagcggatattgttgatttagaatattttaataaagaagaaataaaaacacttggcatt
cgtatattcattgtttcaacatatggaaatggtgacccaccagataatgctatcgaattt
tttaaatggttaaaagaactagatataaataacacatattttaggaatacaaaatattct
ataatgggtttaggaagtaaacaatatagtcattttaacaaaatagcaaaaaaacttaca
gcttatcttaaaaattttaaagcagaacaaattagtgaaactatatatggtgacgatgat
gataatatttatcatgattttgaaatatggaaaaataatttttttaaagaattatcgaaa
attttaaatatgagccatatcccaattaattttatcaaagaagaagttattaaattggtg
gattggaaaaatattcctgacatcaaattcgatttaaaatttgaaaatatcgaagatgat
aagaaaagcgaaacgaaatgccatgctagtaatttattaaaagataatactaatcatcaa
gaagctcaatttaataagcatgtatccacaagtcttactggaaaattttattttaaccac
aatactggcactgtaatatctaacacaaatttgttaaaaaatgtagatgattccactaat
tctgataaagttaatcatataattatatcagcaaaaaatattaaatacaagtctgctgat
actttagttgttttaacaaaaaattcaaaacaaatcacagattggtggttaaaacgatta
aatataaatgaaattgacaaaaataaaaaatttatttttgtggaacgaaatgatcaaaat
tcacaaaaaaactcacaaaaatatgataatacaccatatttaaatggtactaataatgaa
aaaaatgatatattaataaataaaaataatgataataataataataataataataacaat
tccatgcatattccgtttccaacaccatgcacaattgaagaagccttacaatgttattgc
gatttatcaactatacctcgagtaaatgttttaaagaattttaaatgttttattaaagac
atagaagaacttaaaatgtttaattacattttatcaaataataaaaggaatacatttttt
aatatatgcaaagaatttgaaatgacatttattgaatttgtagatatattcatgcaaagt
gccatatttgaattgacgccatttttacaattaattccaaaaatttcccccaaaagctat
acaatatcttcttctccaaaagatgatccagacatgattacattgactgtaaaaaaaaaa
caatatcctattcattcgcttaggaaagcattaaaaagttttaaaaataataatatgtta
ccaaatattactgaaaaaaaattacgaaatttatgtgaaagaagatggtataaaggttca
tcttcttattatttaacagaagaattatatccaaatgatatagtaaaatttaatgttaaa
acatcaatatttacacttcccgaaaatttaggagacgccagcattataatgattgctaca
gggacgggaatagctccttttaaagcttttcttacagaatttaaactttttgaccaaaaa
cgtgaaaaaaatgaaatattaaataaaaaatcccaaagaatattattctatggctgcaga
aaaaaaggaatagattttctatatgaaaaagaaattatggactctttggaaaacaaatat
attgatgaaatttatttagcattttcaagggaccaaagcaataaaatttatgtacaagat
ttaattcgtgaacaaaaggaacttgtgtgtaacttgatacaaaaaggcgcatacgtatac
atatgtggaaataccgaaatgggtaaggatgtgaaacaaacaattgttaatttatatgaa
aataataagcaaaatgataaaaagattataaaaaaattaaagaaatcaggacgatttttc
gaggaaatttggtaa

DBGET integrated database retrieval system