KEGG   Plasmodium berghei: PB000946.02.0Help
Entry
PB000946.02.0     CDS       T01111                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pbe  Plasmodium berghei
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PB000946.02.0
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PB000946.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
KSRRKGKLKYGIENDPTNIITKKKPINVAIFGSTGSIGTNTLSIIRECNKIEKQFNVEAL
YVNKNIEGIYEQAKEFLPKYVCIHDPNKYEELKKLLENIKNYNPIILIGNEGMKQICSSN
EIDKIVIGIDSFQGLYSTIYAIKNNKTIALANKESIVSAGFFLKKLLTVHKNSTIIPVDS
EHNAIFQCLNNNILLKSKCLQENYSKINKINKIFLCSSGGPFQNLSIDELKNVTSEKALK
HPKWNMGKKISIDSATMMNKGLEVIEAHFLFDIDYNDIEIIVHKECIIHSCVEFLDKSVI
SQMYYPDMRVQIIYALTWPNRISTNLKSLNFEEISPLTFYKPSLKHFPCIKLAYHAGRKS
NFFPTVLNASNEVANNLFLNNKIKYFDIPAIISQVLESFNPQQICETPEDLISKF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
aaaagtagaagaaaagggaagctaaaatatggaattgaaaatgacccaactaatattatt
acaaaaaaaaaaccaataaatgttgctatttttgggagtacagggagtataggaactaac
acccttagcattatacgagaatgtaataaaatagaaaaacaatttaatgttgaagcttta
tatgttaataaaaatattgaaggaatatatgaacaagcaaaagaatttttaccaaaatat
gtgtgtatacatgatccaaataaatatgaagaattaaaaaaattattagaaaacataaaa
aactataatccaataatattaattggcaatgaaggtatgaaacaaatatgtagtagtaat
gaaatagataaaatagttattggtattgattcatttcaaggtttgtattcaacaatatat
gcaataaaaaataataaaactattgcattagcaaataaggaatctattgtatcagctgga
tttttcttaaaaaaattattaactgttcataaaaattcgacaataatacctgtagattct
gaacataatgcaatattccaatgtttaaataataatatattattaaaatcaaaatgctta
caagaaaattattctaaaataaataaaataaacaaaatatttttatgttcatctggtgga
ccatttcaaaacttatcaatagatgaactaaaaaatgtaacatctgaaaaagcattaaaa
catccaaaatggaatatgggaaaaaaaatatcaatagattcagcaacaatgatgaataaa
ggattagaagtaattgaagcacattttctttttgatattgattataatgatattgaaata
attgtacataaagaatgtataatacattcatgcgtggaatttttagataaatctgttata
tcacaaatgtattatccagacatgagagtacaaattatatatgcattaacatggcctaat
agaataagtacaaatttaaaatccttaaattttgaagaaatatcacctctcactttttat
aagccatcattaaagcatttcccatgtataaaattggcttatcatgctggacgaaaatca
aattttttcccaacagttcttaatgcatctaatgaggttgctaataacctttttctaaat
aataaaattaaatattttgatattccagctattatatctcaagttctagaatcatttaat
cctcaacaaatttgtgaaacaccagaggatcttataagcaaattt

  All links  
No link information was found.   
DBGET integrated database retrieval system