KEGG   Plasmodium berghei: PB000985.03.0Help
Entry
PB000985.03.0     CDS       T01111                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pbe  Plasmodium berghei
Brite
Enzymes [BR:pbe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PB000985.03.0
Peptidases [BR:pbe01002]
 Cysteine Peptidases
  Family C86
   PB000985.03.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 214 aa AA seqDB search
MCYYKIHKIETENGPVNVYFEKQSKLYCLLHTTNNILQAHIYSPQDFREFENNFDYTKLN
TNTSDNDNNINENKNNKKFIDLNIKDKLNYEHIFSYLKRGINYFGNFNIDVFYFFVSKHN
IELHWVDNKEIFKKLNQNSNCLSLFSDSVLNDQKLIAFVINMVKINFLNIYNHRHFYTIR
KISGMWFVLDSSRSKPILLPTSQDVNIEKNNKIK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtgttattataaaatacataaaattgaaacggaaaacggaccagtaaatgtatacttt
gaaaaacaaagtaaattatattgcttacttcatactacaaataatatattgcaagcacat
atatattctcctcaagattttcgagaatttgaaaacaactttgattacacaaagctaaat
actaacacatcagacaatgataataatataaatgaaaacaaaaataataaaaaatttatt
gacctaaatataaaagacaaactgaactatgaacatattttttcctatcttaaaagagga
attaattattttggaaattttaatattgatgttttttatttttttgtgagtaaacataat
attgaattacattgggttgacaataaagaaatatttaaaaaattaaatcaaaatagcaat
tgtctttcactatttagtgatagtgttttaaatgatcaaaaattaattgcttttgtaata
aatatggttaaaataaattttttaaatatttataatcatagacatttttatacaataagg
aaaatttcaggcatgtggtttgtgttggattcctcgcgcagcaagcccattttgctgcct
actagtcaggatgtaaatatcgaaaaaaataataaaataaaataa

DBGET integrated database retrieval system