KEGG   Plasmodium berghei: PB001039.02.0Help
Entry
PB001039.02.0     CDS       T01111                                 

Definition
3-hydroxyisobutyryl-coenzyme A hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
pbe  Plasmodium berghei
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB001039.02.0
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PB001039.02.0
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PB001039.02.0
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PB001039.02.0
Enzymes [BR:pbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     PB001039.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 246 aa AA seqDB search
VLSKKMENTNENINMNKRYISDECNKGDLFRKTEKDKNNELDRYNVENMNDGIKSKKSNS
DDIIDLTLSDVWSKKTLIVEYKNNIIEILLNRKEKLNAINKDMINGLLNMVKSLSNDDRC
NLIVIRSINQNCFCSGSDVKDIVQNKDQGINHLKQLYKYINFISKINKNILCIWNGYAMG
GGLGISMYTQYRIINTNVIFSMPENKIGFFPDVGSSYFLKKYFSRNIALHLGLTSLRLNE
IDLINF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtattatctaaaaaaatggaaaatacaaatgaaaatattaatatgaacaagcgatatata
tctgacgaatgtaataaaggcgacctttttaggaaaactgaaaaagataaaaataatgaa
ttagatagatataatgtggaaaatatgaatgatggtataaaatcaaagaagagtaacagt
gatgatattatagatctaaccctatctgatgtatggtcaaaaaaaacattaatagtagaa
tataaaaacaacataatcgaaatattgttaaataggaaagaaaaattaaatgctataaat
aaagatatgattaatggattattaaatatggtaaaaagtttaagcaatgatgatagatgt
aatttgatagtaataagaagcatcaatcaaaattgtttttgttcgggttcagatgtaaaa
gatatagttcagaataaagatcaagggataaatcatttaaaacaactttataagtatatt
aattttatttcaaaaatcaataaaaatatattatgcatatggaatggatatgctatgggt
gggggattaggtatatctatgtatacacagtatcgaatcataaatacaaatgtaatattt
tccatgccagaaaataaaataggttttttccctgatgttggaagctcttattttttaaaa
aaatatttttcacgaaatattgctttacacttaggattaacatcattgcgattaaatgaa
attgatttaattaatttt

DBGET integrated database retrieval system