KEGG   Plasmodium berghei: PB001051.00.0Help
Entry
PB001051.00.0     CDS       T01111                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
pbe  Plasmodium berghei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 118 aa AA seqDB search
MVSKKPAKEKKATNGATDGKKKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFL
VDTFEKIATEASRLCKYTKRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggtatccaaaaagccagctaaagaaaaaaaagcaaccaatggtgctactgatggaaag
aaaaaaagaaaaaagtcaagatatgacagctatggactttacatatttaaagttttgaaa
caagtccacccagacactggtatttcaaggaaatccatgaacatcatgaattccttcctt
gttgataccttcgaaaaaatcgcaactgaagcatcaagattatgtaaatataccaaaaga
gatacattatcatctcgtgaaatccaaactgctataagattagtattaccaggagaatta
gcaaaacacgccgtatctgaaggaaccaaagctgttacaaaatttacctccaaataa

DBGET integrated database retrieval system