KEGG   Plasmodium berghei: PB001123.00.0Help
Entry
PB001123.00.0     CDS       T01111                                 

Definition
histone acetyltransferase Gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pbe  Plasmodium berghei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 700 aa AA seqDB search
RMENLKFNDNIDLKNVDGIDLSSYFVNGKYCSKLANHEKIYNIIYYIVKNSLHEYLTDFY
NNEDLGYKEKEDDNVSNLLKNETTNYRETNTIDSDKNPKGEHDILLECSEKIIEKEENNK
NKRNSDDIDGKEIDQDDGNDDNIIQKKKKKKIENEGNENIEIDQDVNINNTEKSMNNNSL
RQKMNDNENNYILSEITKSICSILNLQQLMPVNTRLSNPGLIYDPNYETIYSKWKLFLKK
EQSSGNIISKCFSRDFLHTVLLCNYDSIIEDLKKTAVKKKIKYFFLHICLESDIPINVAL
MLFLNATKQSDKLQSLLPSETGLGYLHRDAGGAKEENMGIITFECITNDREPDHLIKLIT
LKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQKFAEIAFLAVT
STEQVKGYGTRLMNHLKEHVKKFGIEYFLTYAVFFRLVVSMTLSINLTLIYFFTFLDNFA
IGYFRKQGFSQKISMPKERWFGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKTVKKA
IHFIKPQIIFKGLNYFTENKGGNLHPNNIPGLLEIGWKKEYKDMTTKKTHHKEIQLKDQI
INVLDYLEKQQSAWPFLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGEYKTKEDFGIEL
KRMFDNCRLYNAPTTIYFKYANELQALIWPKYEEISEMAK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
cgtatggaaaacttaaaatttaatgataatatagatttaaagaatgtagatggaatagat
ttaagttcatattttgtaaatggaaaatattgctctaaattagctaatcatgaaaaaata
tataatataatttattatattgttaaaaattcattacatgaatacttaactgatttttat
aataatgaagatttaggatataaagaaaaagaagacgataatgtttcaaatttgttaaaa
aatgaaactacaaattatcgagaaacaaacacaatagattcagataaaaatccaaaagga
gagcacgatatattattagaatgttctgaaaaaataattgaaaaagaagaaaacaacaaa
aataaaagaaatagtgatgatattgatgggaaagaaattgatcaagatgatggaaatgat
gataatataatacaaaaaaaaaaaaaaaaaaaaattgaaaatgaaggaaatgaaaatatt
gaaatagatcaagatgttaacataaataatacagaaaaatctatgaataataatagtttg
agacaaaaaatgaatgataatgaaaataattatatattaagtgaaataacaaaaagtatt
tgttctatattaaatttacaacaactaatgccagtaaatacaagattaagtaatccaggt
ttaatttatgatcctaattatgaaacaatatattcaaaatggaaattatttttaaaaaaa
gaacaatcaagtggaaatattataagcaaatgtttttcacgggattttttacatactgtt
ttattatgtaattatgatagtataattgaagacttgaaaaaaacagcagtgaaaaaaaaa
ataaaatatttttttcttcatatttgcttggaatcagatattcctatcaatgttgcattg
atgctctttttgaatgcaacaaagcaaagcgacaagctgcagtccctattaccatcagaa
actggattgggatatttgcatcgagacgctggaggagcaaaagaagaaaacatgggaatt
ataacttttgaatgtataacaaatgacagagagccagatcatttaattaaattaataaca
ttaaaaaatatattttcaagacaattacctaaaatgcctagagagtatattgtcagattg
gtatttgataggaaccattatacattttgtttacttaaaaaaaatacagtaattggtggt
gtttgttttagaccatattttgaacagaagtttgctgaaattgcatttttagcagttaca
tcaacagagcaagttaaaggatatggaactcgacttatgaatcatttaaaagagcatgtt
aaaaaatttggaattgaatattttctaacatatgcagttttttttcgcttggttgtatcc
atgactttgtcgattaatttaaccctgatttatttttttacttttttagataactttgcc
atagggtattttagaaaacaaggattttctcaaaaaatttcgatgccaaaagaaagatgg
tttggatatataaaagattatgatggagggacattaatggaatgctatatatttccaaat
ataaattatttaagattatctgaaatgttatatgaacaaaaaaaaacagtaaaaaaggca
atacattttataaagccacaaattatatttaaagggttaaattattttactgaaaacaaa
ggagggaatttacaccctaataatattccaggtttattggaaattggatggaaaaaagaa
tataaagatatgacaacaaaaaaaacgcatcataaagaaattcaattaaaagatcaaatt
ataaatgttcttgattatttggaaaaacagcaatctgcttggccttttttaaaaccagtt
agtctttctgaagccccagattattatgatatcattaaagaacccactgatatcttaacg
atgcgaaggaaagctcgtcatggtgaatataagacgaaagaggactttggaattgagcta
aagaggatgtttgataactgtcgattatacaatgctccgacaacgatatactttaaatat
gcaaatgaattacaagctttaatctggcccaaatatgaagaaattagcgaaatggcaaag
taa

DBGET integrated database retrieval system