KEGG   Plasmodium berghei: PB001126.00.0Help
Entry
PB001126.00.0     CDS       T01111                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
pbe  Plasmodium berghei
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PB001126.00.0
Exosome [BR:pbe04147]
 Exosomal proteins
  Proteins found in most exosomes
   PB001126.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1197 aa AA seqDB search
LSDSVCQDLLFDFMKGNKVNIEIIISICVQYYNKIGIKKIVNKFEENKNYEGIFYFISSI
LNELQNMSTARNANDIGKYNDNNSISSNNNINNNLSSSRSNNDDASSILLNSDIGIGTQF
SYENNSALTIEDLHHIMFKYIEACVKINNIQELDRICKDRNAKYNPEQIKNFLKECKLSD
PRPLIYVCDIHNFIEELAEYLYKNSLLKYIEVYVIKVNPHNAHKVIGVLLDLDASEDFLL
NLLNNIKNISNIGNLIDIAEKRNRLKLLLPWLESRSNECYENIELHNALAKIYIDLNKDP
ETFLKNNNFYDKKMIGKYCEDLDPHLAYTAYERSNGQCDEELINITSKNGLFKLQAKYLV
SRQSMGLWSMVLDELNKYRKNVIDQVIGSTLIESNNADEITVTVKAFIEKKLSSELIELL
EKIVLHNSEFRDNKNLQNLLILTAIKSDSKKVMEYINRLDNFSGSQIAEVAYEYKLREEA
FVIYKKFNCNTSAISVLLDNILIFNQNRKGKMSANARRKKTEFALFNTINDYSVNDSDGY
LNVTNFSGALSSSYNEKRDGVSSIYGSNEAFRNYGSGQLSEFEEESKEEQEMEKEEKLTN
VEKYEEDLNRAIEFAQKCNVNDVWFILGKAQLKLNKIIDAIDSFIKSNNAGAYKEVIEKC
KENNFYEQLITYLNTLREQNSLKDVLVDSELLYAYAKLKKTLEMTKFIASTNLANMQLIG
DRLYKEKEYDAAKILYSSIPNNQKLTFCHLKLKEYSLAIEAAKKTKSLKTWREVNLVCVK
YKQLKFAHVAGLQLIMHADHLDEIIKIYEKKKYINELLSLLENGLNSERAHVGIYTELGM
LYAKYKPEKLMEFIRSYTNKMNTRKLIDACHNEYLLKEAVYLYISYDEYNLAVDTIIKHS
PIAYQPDIFMQVIHKVTNSDIIHKVIDFYIEENPLNLYNLLKILENKIDNNRLVQTMKKS
NNLPLIQKYLEDIQTQNITSVNETLNEIYLENDDYISLRKSIDEYDNFNQTNLINKLENH
KLAEMRRIAALLYKKNKKFKEAINLSKKEGQIKDAIDIARVSKNHLYVEDLINYFIQIKN
KEALCACLIACYDILKPDYVLEIIWLSGFKDHAMLYFIQIISDYTQQIETMKKQIEDIEK
EKKMNKSAPNDFSANTISNQFTYSLNKNLSIMPPQNNYIPNNSDFDKYDMFNTNTHF
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
ttaagtgattcagtttgtcaagatttgttatttgattttatgaaaggaaataaagtaaat
attgaaattataatttcgatatgtgttcaatattataataaaattggaattaaaaaaatt
gtgaacaaatttgaagagaataaaaattatgagggaatattttattttattagttctata
ttgaatgagttacaaaatatgagcactgctagaaatgctaatgatataggcaaatataac
gataataatagtattagtagtaataacaatattaataataatttgtcaagctctagaagt
aataacgatgatgcatcatctattttactaaattcagacattggaattggcacacaattc
tcctacgaaaataattcagctttaactattgaagatttgcatcatataatgtttaaatat
atcgaggcatgtgtaaaaattaacaatattcaagaattagatagaatatgtaaagacaga
aatgcaaaatataaccctgaacaaataaaaaactttttaaaagaatgcaaattatcagac
cctcgtccattaatatatgtatgtgatatacataattttatagaagaattagctgaatat
ttatataaaaatagtttgttaaaatatattgaagtatatgttattaaggtgaacccacat
aatgctcataaagttattggtgttctattagatttagatgcatcagaagattttcttctt
aatttactaaataatataaaaaatatatcaaacattggtaatttaatagatatagcagaa
aaacgaaatcgactaaaattattattaccatggcttgaaagtagatctaatgaatgttat
gaaaatatagaattacataatgctttagcaaaaatttatattgatttaaataaagatcct
gaaacatttttaaaaaacaacaatttttatgataaaaaaatgataggaaaatattgtgaa
gatttagacccacatttagcatatactgcatatgaaagatcaaatggccaatgtgatgaa
gaacttataaatataacaagtaaaaatggcctttttaaattacaagctaaatatttagta
tctaggcaatcgatgggactatggtcaatggtattagacgaattaaataaatatcgaaaa
aatgtaatcgaccaagttataggttcaactttaattgaatcgaataatgctgatgaaatt
actgtaactgttaaagcatttattgaaaaaaaattaagtagtgaattaattgaattacta
gaaaaaattgtattacataatagtgaatttagggataataaaaatttgcaaaatttgtta
attttaacagctatcaaatcagattcaaaaaaagttatggaatatattaacagactagac
aacttttcaggttcacaaatagccgaggttgcatatgaatacaaattaagagaagaagct
tttgtcatatataaaaaatttaattgcaacacatctgctatttcagttttattggataat
atcctgatttttaatcaaaaccgaaaaggtaagatgtcagcaaatgctcgaaggaaaaaa
accgagtttgctttatttaatacaattaatgattactctgtaaatgattctgatggttac
ttaaatgttacgaatttttcaggggcgttaagtagctcttataatgaaaaacgtgatgga
gtatcatcgatctatggaagtaatgaagcattccggaattatggaagtggacaattatct
gaatttgaagaagaaagtaaagaggaacaagaaatggaaaaagaggaaaaacttactaat
gtagaaaaatatgaagaagatttaaatagagctattgaatttgcacaaaaatgtaatgta
aatgatgtatggtttatattaggtaaggctcaattaaaattgaataaaattatcgatgcg
attgacagctttattaaatcaaataatgcaggtgcttataaagaggttatagaaaaatgc
aaagaaaacaatttttatgaacagttaataacttatttaaatacattaagagagcagaat
tcattgaaagatgtattagtagattctgaattattatatgcatatgccaaattaaaaaaa
acattagaaatgacaaaatttatagctagtacaaatttagcaaatatgcaattaattggt
gatagattatataaagaaaaagaatatgatgcagcaaagatattatatagtagtatcccg
aataatcaaaaactgaccttttgccatttaaaattaaaagaatattcattagctatcgaa
gccgctaaaaaaacgaaaagtcttaaaacttggagagaagtaaacttagtatgtgtaaaa
tataaacaattaaaatttgcacatgtagcaggattgcaactcattatgcatgcagatcat
ttagatgaaatcataaaaatttatgaaaaaaaaaaatatataaatgaactattgagttta
ttggaaaacgggctaaatagtgaaagggcacatgtaggaatatatacagaattaggaatg
ttgtatgcaaaatataaaccagaaaaattaatggagtttataagaagttatactaataaa
atgaatacaaggaaactaatagatgcatgtcataacgaatatttattaaaagaagcagta
tatttatatatatcatatgatgaatataacttagctgttgatacaattattaaacactct
cctattgcttatcagcctgatatatttatgcaagtaatacataaggtgacaaatagtgat
ataatacacaaagtaatagatttttatattgaagaaaatccattgaatttatataattta
ttaaagattttagaaaataaaattgataataatagattagtacaaacaatgaaaaaatca
aataatttgccattaatacagaaatatttagaagatattcaaacacaaaatattacatct
gttaatgaaaccctaaatgaaatttatctagaaaatgatgattatattagtttaagaaaa
tcgatagacgagtatgacaattttaatcaaacaaatttaattaataaattggaaaatcac
aaattagctgaaatgagaagaattgcagcattattatataaaaaaaataaaaaatttaaa
gaagctattaatttatcaaaaaaagaaggacaaattaaagatgctattgatattgctaga
gtttctaaaaatcatctatatgtcgaggatctaattaattattttattcaaattaaaaat
aaggaagctttatgtgcatgtttaattgcttgttatgatatattgaaaccagattatgtt
ttagaaattatatggttgagtggatttaaagatcatgctatgttatatttcatacaaatt
attagtgattatactcaacaaatcgaaaccatgaaaaaacaaatagaagatatagaaaag
gaaaaaaaaatgaataaatcagctcctaatgatttttctgccaatactatttcaaaccaa
ttcacctattcattgaataaaaacttatccattatgcctccacaaaataattatatccca
aataattcagactttgacaaatatgacatgtttaatacaaatacacatttttaa

DBGET integrated database retrieval system