KEGG   Plasmodium berghei: PB001222.02.0Help
Entry
PB001222.02.0     CDS       T01111                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pbe  Plasmodium berghei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PB001222.02.0
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PB001222.02.0
Enzymes [BR:pbe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PB001222.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 378 aa AA seqDB search
LCDIYKMGRIIDSILSGGVFLTATLLTYKYLKDRKRKLIIEGQCEAKNKFNIDLNKIIEK
MKNKNIINIDDINDEELLVILFTAKTFEKILRDKKDSKYLKDKVFCSLFTEPSTRTRCSF
DSAILRLGSKVINITDVNSTSFYKGETVQDTFSVMSKYVDGIIYRDASNNNIELAIETSS
KPIINAGNGTGEHPTQSLLDFYTIYNFFPYILNRDPNKQLKVAFVGDLKNGRTIHSLSKL
LSRYNVSFNFISCKSLDIPDNIINIISDNLKKNNFYDNNSINKYDNLEKGLEGTHIVYMT
RIQKERFSDMSEYNKYKDSFILDNNTLKNTRPNAKVLHPLPRVNEIKIEVDKNPKSVYFL
QAENGLYVRMALLYLIFS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttatgcgatatatacaaaatgggtaggatcattgattcgatactttcagggggcgttttt
ttaacagccacattattaacatacaaatatcttaaagacagaaaaaggaaactaataatt
gaaggacaatgtgaagctaaaaataaattcaatatcgatctgaataaaataatagaaaaa
atgaaaaataaaaatattataaatattgatgatataaatgatgaagaattgttagtaatt
ttatttacagcaaaaacatttgaaaaaatattaagagataagaaggactccaaatatttg
aaagataaagttttctgtagcttatttaccgaaccaagcacacgaacgagatgctctttt
gattctgctattttaagattgggttcaaaagtaataaatattacggatgtaaattcaact
tccttttataaaggagaaactgtgcaggatactttttctgttatgtcaaaatatgttgac
ggaattatatacagagatgcctcaaataataatatcgaattggcaattgaaacatcaagt
aagccaataatcaacgcggggaatggaactggagaacatccaacacaatcacttttagac
ttttatacaatatataatttctttccatatattttgaatagagatccaaacaaacaactt
aaggttgcatttgttggtgatttaaaaaacggaagaactattcattctcttagtaaatta
cttagtagatataatgttagtttcaattttatttcatgtaaatcattagatattcctgat
aatataataaatattatatctgataatttgaaaaaaaataatttttatgacaataattct
ataaacaaatatgataatttagaaaagggattagaaggtactcatattgtatatatgaca
agaattcaaaaagaaagattttcagatatgagcgaatataacaaatacaaagattctttc
attttggataacaacacattaaaaaacacaagacccaacgccaaggtccttcaccccctt
ccgagggttaacgaaataaaaatagaggttgataaaaatcctaaaagtgtgtattttttg
caagctgaaaatggcctatatgtacgaatggcgttattataccttattttctcataa

DBGET integrated database retrieval system