KEGG   Plasmodium berghei: PB001306.02.0Help
Entry
PB001306.02.0     CDS       T01111                                 

Definition
histone h2b
Orthology
K11252  
histone H2B
Organism
pbe  Plasmodium berghei
Brite
Exosome [BR:pbe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PB001306.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 123 aa AA seqDB search
MSGKGPAQKSQAAKKTAGKTLGPRHKRKRRTESFSLYIFKVLKQVHPETGVTKKSMNIMN
SFINDIFDRLVTEATRLIRYNKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGA
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaaaggaccagcacaaaaatcacaagctgcaaagaaaacagcaggaaaaact
ttgggaccaaggcacaaaagaaaaagaagaacagaatctttttcactttacatttttaaa
gttttaaaacaagtccacccagaaacaggagtaacgaaaaaaagcatgaacattatgaat
tcatttatcaatgatatttttgacagattagttactgaagcaactagattaattcgttac
aataaaaaaagaactttgtcatcacgtgaaattcaaactgcagttagattacttttacct
ggtgaattatcaaaacatgctgtttcagaaggtacaaaagctgtaacaaaatacactacc
agtggtgcataa

DBGET integrated database retrieval system