KEGG   Plasmodium berghei: PB001331.02.0Help
Entry
PB001331.02.0     CDS       T01111                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pbe  Plasmodium berghei
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pbe00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 116 aa AA seqDB search
MSQRPEPQVDVPSGDYKKGAKIFKAKCAQCHTMNKGGAVKQGPNLYGFYGRKSGESDFPF
SDANKNSGIIWSDKHLYEYLLNPKLYIPGTKMIFAGIKKEKERADLIEYLKKASSE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaagaccagaaccccaagttgatgtcccttctggtgattataaaaaaggagca
aaaatttttaaagcaaaatgtgcccaatgccacacaatgaataagggtggagctgttaaa
caagggcccaatttatatggattttatggtagaaaatcaggagagtctgattttccattt
tcagatgcaaataagaattctggaatcatatggtctgataagcatttatatgaatattta
cttaaccccaaattatacattccaggaacgaaaatgatttttgccggcataaaaaaagaa
aaagaaagagcagatttaatcgaatatctcaaaaaggcttcatctgaataa

DBGET integrated database retrieval system