KEGG   Plasmodium berghei: PB001352.02.0Help
Entry
PB001352.02.0     CDS       T01111                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
pbe  Plasmodium berghei
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 545 aa AA seqDB search
MTIVKVTVKWKTNIYNDLELNINEPIALFKEQLWKITSVPPEKQKLMYKGLIKNDTNLHT
LNIKNNDKIMLVGSSELLAEKPDKITFFEDLSKEDKEKLNEDKNIIFEEQGIVNLGNTCY
FNAVLQFLTSFNDLGEFLSNIKKTQNFGFRSNKDILFDCYIHFSQTFGKSSKPYVPLELL
KAFRDVFPKFKTINIRTKQYAQQDAEECMNAILTSLNDHTESKIIDKLFSFKIIGKIKCV
EQNSQDDEPNKQKESQKNENSQKPESDKNNPSQNEENDHFELTQEKHNKLICYMGTQNTP
VNHLHEGIRLSLIEKIKKKKNDNDKEDTLYEKKSEIDSLPPYLIIHFLRFESKRIVDTSN
TVSVVTAKICRKVSFPEIFDIYDFCSDRIKADLKISRNIIMNRKDIKTPIVQENKNEDDK
MLETLTNQDDKNKEFVEIPNGEYELISVITHKGRNEESGHYIAWKKMRNRVNKNSEYDAN
GPRTKKNKSNNEPTWFKMDDDKVSLHNFSSLDLFGGCSDYNTAVLLLYKRKTISCTKDEL
NKYSV
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagttaaggtaacagtaaaatggaaaacaaatatttacaatgatctagagctc
aatataaatgagccaatagcattgtttaaagagcagctatggaaaataacttctgttcct
ccagaaaaacaaaaactaatgtataaagggttaataaaaaatgacaccaatttgcataca
ttaaacataaaaaataatgacaaaattatgttagtaggatcttcagaattattggctgaa
aaacctgataaaattacattttttgaagatttatcaaaagaagataaagaaaaattaaat
gaagataaaaatattattttcgaagaacaaggtatagtaaatttaggaaatacttgttat
tttaatgcagttttgcaatttttgacttcttttaatgatttaggagaatttttaagtaat
ataaaaaaaacacaaaattttggatttagatcaaataaagatattttattcgattgctat
atacatttttctcaaacttttggaaaatcatcgaagccatatgttcccttagagttatta
aaagcctttagagatgttttcccaaaatttaaaactattaatataagaacaaaacaatat
gcacaacaagatgcagaagaatgtatgaatgctattcttacctcattaaatgatcataca
gaatcgaaaattattgataagcttttttcatttaaaataattggaaaaattaaatgtgta
gaacaaaatagtcaagatgatgaacctaataaacaaaaagagtcacaaaaaaatgaaaat
tcacaaaaaccagaatcagacaaaaataatccaagtcaaaatgaagaaaatgaccatttt
gaattaacacaagaaaaacacaacaaattaatttgttatatggggacgcaaaatacccca
gtaaatcatcttcatgaaggtattagattatcattaattgaaaaaataaaaaaaaaaaaa
aacgacaatgataaagaagatacattatatgaaaaaaaatcagaaatagattcattacct
ccttatttaattatacattttttacggtttgaatcaaaacgaattgtagatacaagtaat
acggtttctgttgttactgccaaaatatgtagaaaggtttcctttccagaaatttttgat
atttatgatttttgctctgataggataaaggctgatttaaaaatttctagaaatattatt
atgaacagaaaggatattaaaacacccattgttcaggaaaataaaaatgaagacgataaa
atgttggaaactttgactaaccaggatgataaaaacaaagaatttgttgaaatcccaaac
ggagagtatgaactaatttcagttatcacacataaaggaagaaatgaagaaagtggacat
tatattgcatggaaaaaaatgcgaaatcgtgtaaataaaaattcagagtatgatgctaat
ggcccaagaactaaaaaaaataaaagtaataatgaaccaacatggtttaaaatggatgat
gataaagtaagtcttcacaatttttcatctcttgatttatttggaggatgtagtgattac
aatacagctgttttgttattatacaaaaggaagacaatttcttgtacaaaagacgaatta
aacaaatactctgtttga

DBGET integrated database retrieval system