KEGG   Plasmodium berghei: PB001566.02.0Help
Entry
PB001566.02.0     CDS       T01111                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pbe  Plasmodium berghei
Brite
Enzymes [BR:pbe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PB001566.02.0
Peptidases [BR:pbe01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PB001566.02.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 103 aa AA seqDB search
MTKKKKWIPIESNPDSLYLYSCKLGQQKLSFVDIYGFNKDLLDMIPKPVHAIIFLYPIKD
DIVIIKSIGSSHINTTNGDINIWFIKQVNKLIKLNFSNINICI
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaaaaaaatggataccaatagaatcgaatcccgattcgttgtatttgtac
tcttgtaaacttggacaacaaaagttaagttttgtagacatttatggttttaacaaggat
ttattagatatgatacccaaacctgttcacgcaataatattcttatatccaataaaggat
gatatagtaataattaaaagcattggttcaagccacataaatacaacaaatggtgatatc
aacatttggttcataaagcaagtaaacaaattaataaaattgaatttttccaatattaat
atatgtatatag

DBGET integrated database retrieval system