KEGG   Plasmodium berghei: PB301230.00.0Help
Entry
PB301230.00.0     CDS       T01111                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pbe  Plasmodium berghei
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pbe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PB301230.00.0
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PB301230.00.0
Enzymes [BR:pbe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PB301230.00.0
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 201 aa AA seqDB search
TMRILLILKLSILFLFARENFITMFSYFKKITVIKSDLKPSIYDYNVKSLDGINIPMSTY
KNKVLIIFNSASKCGLTKNHINQFNTLYEKFNHKGLEILGFPTYQFFNQEYKQSCDISQF
NQEKNIKYHVFAPIEVNGTNTHELFKYLKFNCNEMHDENGVLDNIGWNFGKFLIDRYGNV
VKYFSPKISPSNMEKYITDLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
acaatgcgaatattattaatacttaaattaagtatattatttttatttgcccgtgaaaat
tttatcacaatgttttcctattttaaaaaaataactgtaataaaaagtgatttgaagcct
tctatatatgactataatgtgaaatcgttagatggaataaatatacctatgtcaacatat
aagaacaaagttttgattatttttaattccgcatcaaagtgtggtttaacaaaaaatcat
attaaccagtttaatacattatatgaaaagttcaatcataaaggattagagatcctagga
tttcctacgtatcagttttttaaccaagaatataaacaaagttgtgatatcagtcaattt
aatcaagaaaaaaacataaaatatcatgtattcgctcctattgaagtaaatggaacaaat
acccacgaactttttaaataccttaagtttaactgtaatgagatgcatgatgaaaatggc
gtattagataacattggatggaattttggaaaatttttaatagatagatatggaaatgta
gttaaatatttttcgccaaaaattagcccatcaaacatggaaaaatatattaccgattta
ttataa

DBGET integrated database retrieval system