KEGG   Python bivittatus (Burmese python): 103048475Help
Entry
103048475         CDS       T03091                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    103048475
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     103048475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 265 aa AA seqDB search
MHCLPSLVMALSALLVALGVLHLWLFHHQPSCYGKHEPCQPKEGKHPAARAPRRAHLPTR
CAWFLQELPAFLVPVLLLALRNPPRFAPLGCRLLGSMFCGHYFHRTFIYSFFRRGRPFPL
KILFFGVLFCIYNGFLQGYYMVYCAEYPDDWCKDIRFMSGLLLFLFGMGVNIHSDFLLRQ
LRKPGEFTYKIPQGGLFAYVSGANFFGEILEWFGYAIATWSLPALAFAFFTLCFIGPRAY
HHHRYYLKKFTGYPRSRKALIPFIF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcttgccgagcctggtgatggccctcagcgccctgttggtggccttgggggtg
ctgcacttgtggctattccatcaccagcccagttgctacgggaagcacgagccctgccag
ccaaaggaggggaaacaccccgccgcgagggcgccgcgccgcgcccacctgcccacccgc
tgcgcctggttcctgcaggagctgcccgccttcctggtgcccgtgcttttgctggcgctg
cgcaacccgccacgcttcgcgccgctcggctgcagactgctgggcagcatgttctgcggc
cactatttccacaggacattcatttactcattcttccgaagaggcaggcctttcccactg
aagatactgttttttggtgtactgttctgtatctataatggcttcctccaaggttactac
atggtttattgtgctgaatacccagatgactggtgcaaagacatacgatttatgtcaggc
ctcttgttgtttttgtttggcatgggagtcaatattcacagtgattttcttctgcgtcaa
ctaagaaagcctggagagttcacttacaaaattccacaaggaggattgtttgcgtacgtc
tcaggagcaaatttctttggggaaatcctggaatggttcgggtatgctatagcgacctgg
tctctaccagccttagcctttgcattttttacactctgcttcattggaccacgtgcttat
catcatcacaggtattatttgaagaagttcactggctatccaagatcaagaaaagccttg
attccttttatattctga

DBGET integrated database retrieval system