KEGG   Python bivittatus (Burmese python): 103048588Help
Entry
103048588         CDS       T03091                                 

Definition
lysozyme C-1-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
pbi  Python bivittatus (Burmese python)
Brite
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     103048588
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103048588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 147 aa AA seqDB search
MKALVLTLLFLLLAASEAKVFIRCELASLLKRHGLDGYHGYSLGNWLCMAYHESRYNTKS
VGXPNSDGSHDYGIFQINSRWWCNNKQGRTANGCKKLCSAFTNDDITDDIACAKRIVRDP
NKMGAWVAWRNNCRGKDLSKWTRGCKL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcattagtgctcaccctcctcttcctcctccttgcagccagcgaggccaaagta
tttatcagatgtgaactggcttcacttctcaaacggcatggactggatggatatcatggc
tacagcttgggcaactggctctgtatggcttatcacgagagcaggtacaacaccaaatct
gtggggtagccaaactcggatggcagccacgactatgggattttccagataaacagccgc
tggtggtgcaacaataaacagggccgtacagctaatggctgcaagaagctttgcagcgct
ttcaccaatgatgacatcacagatgatattgcttgtgctaagagaattgtgcgtgatccc
aataagatgggtgcctgggttgcctggagaaataactgcagaggaaaagatctgtcaaag
tggactcgtggctgcaagctctga

DBGET integrated database retrieval system