KEGG   Python bivittatus (Burmese python): 103050521Help
Entry
103050521         CDS       T03091                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    103050521
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103050521
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S33
   103050521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 95 aa AA seqDB search
MKSGHSARMPEENSPRRTPQKIPYQDLPHLVNADGQYLFCRYWKPAATPRGLVFVVHGAG
EHCCRYDDLAKMLTGIDFFVFAHDHGECHWKKTLC
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaggtcactctgccagaatgccagaagaaaattccccaaggagaactcctcag
aaaatcccgtaccaggaccttcctcacttggtcaatgctgatgggcagtatcttttctgc
aggtactggaagccggctgccactccaaggggcctggtgttcgttgttcatggtgctgga
gaacactgctgtcgctatgatgacttggccaagatgctgacaggaatcgacttttttgtg
tttgcccatgaccatggtgagtgtcactggaaaaaaactctgtgttga

DBGET integrated database retrieval system