KEGG   Python bivittatus (Burmese python): 103053687Help
Entry
103053687         CDS       T03091                                 

Definition
sperm acrosome membrane-associated protein 3-like
Organism
pbi  Python bivittatus (Burmese python)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 130 aa AA seqDB search
MAKMMTFLLEAALLACFVATIQTKVYGRCELAHVLKKNGMDRYEGYSLSDWICMAFYESG
FDTETIDWHKGGTKDYGIFHINSGRWCKDNGTLSKVICGVACSDLLNPDLEDDIACVKKI
VKDPAGMAAW
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatgatgactttcttgctagaggcagcccttctagcttgctttgtggctact
attcaaaccaaggtctatggtcgctgtgagttggcccatgtgttgaagaagaatgggatg
gatagatacgaaggttatagcctatccgactggatctgcatggcattttatgaatccggc
tttgacaccgaaaccattgattggcacaaaggtggcaccaaagactatggcatcttccat
atcaacagtggtcggtggtgtaaagataacggtaccttatcgaaggtcatctgtggcgta
gcttgctcagatttgctgaatcctgatcttgaagatgacatcgcctgtgtcaaaaagatt
gtgaaagaccctgctggcatggctgcctggtag

DBGET integrated database retrieval system