KEGG   Python bivittatus (Burmese python): 103061498Help
Entry
103061498         CDS       T03091                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
pbi  Python bivittatus (Burmese python)
Brite
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     103061498 (EEF2K)
Protein kinases [BR:pbi01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   103061498 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 762 aa AA seqDB search
MAGEDLIFHMEYLDNARLTKPGCGNCHDADSDEEENYYICPITDDPVLSKAAGDKVHNYY
SNLVKNEQYSSSSSPQNSFHFRNGTQHPSKHSAPTDHGREAWKHAIEKAKHMPDPWAEFH
LEDIKMENATRYRYNAVTGEWIEDEVLIKMAAQPFGRGAMRECFRTKKLSNFLHTQNWKG
AFNYVAKRYIETVNRDVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIVQTCIIEMKNRPGR
PLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIIVDIQGVGDLYT
DPQIHTESGTDFGDGNLGVRGMALFFHSHACNRICQSMGLMPFDLSSKEKDALFRSSKLL
ESAQTVVRGTEEKCGSSRVRTVSGSRPPLLFRLSENSGDESMSDVVFDSLPSSPSSATPH
SQKMEGLHWPVFNEVDNLVQKDHEGFDSQKDSENGGDSGYPSEKRSDHEDMDHREKGHLN
CNRRHESDEDSLGSSARRNAVLNKLSETTKTSSRNKRVSVEKWNLYNAARVHIHRPSCVA
VEVQRLNALELEKKIGKSILGKVHLAMVRYHEAGRFCEKDQGWDEDSALFHLEHAAECGE
LEAIVGLGLMHSQLPHHILSEVTLQDTKQNRIKGFEYLCQAAEAGDRPSMILVARAYDTG
VNLAPDRQQDWKEALYWYDKALNMTDYDEGGEYDGTQDEPRYLLLAKEAEMLMLGGFNLD
KDPQRSGDLYTEAAEAAIQAMKGRLANQYYQKAEEVWAMMED
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgaagacctcatctttcacatggagtatcttgacaatgccaggctgaccaaa
ccaggttgtgggaactgccacgatgctgacagcgacgaggaggagaattactatatctgc
ccgatcaccgacgaccctgttttgagcaaggcagccggggataaagttcataactattat
agcaacttggtaaaaaatgaacaatattcctccagctcttctccgcagaattccttccat
tttaggaatgggactcagcacccctctaagcacagcgccccgactgaccacggacgggaa
gcctggaaacatgccattgagaaagccaaacacatgcccgacccctgggctgaatttcac
ctggaggacatcaaaatggaaaacgccacccgctacaggtacaatgccgttactggagaa
tggattgaagacgaggtcttgatcaaaatggctgcacagccttttggccgaggagcgatg
cgggaatgcttccggacgaaaaagctgtccaattttttgcacacgcagaattggaaaggg
gcctttaattacgtggcaaagaggtacatcgagacggtgaacagggacgtctattttgag
gatgtgcggctccaaatggaagccaagttgtggggagaagaatataatcgccataagccc
cccaagcaggtagatattgtccagacctgcataattgaaatgaagaacaggccagggcga
cctcttttccacctggagcattacattgaggggaaatacatcaaatacaattcaaactca
ggattcgtacgagacgacaacatccgtctgaccccgcaggcctttagtcatttcactttt
gagcgctcaggacaccagctgatcattgtggacatccagggggtaggagacctttacacg
gatcctcagatccataccgagagcggcacagattttggagatgggaatctcggtgtgcga
gggatggcgttgttcttccattctcacgcctgcaacaggatttgtcaaagtatggggctg
atgcctttcgatctctcctccaaagagaaggacgccttgtttcggagtagcaaactactc
gaatcggctcagactgtcgtacggggcacagaagagaaatgtggcagtagccgtgtgaga
accgtctctggcagtcgtccccccctccttttccgcctttccgaaaactcgggggacgaa
agcatgagcgatgtggtgttcgactcgttgccctcttccccttcttcagcaacgcctcac
agccaaaaaatggagggtcttcactggcctgtatttaatgaagtcgacaacttggtccag
aaagaccacgaaggctttgacagtcaaaaggactctgaaaatggaggtgacagtggatac
cccagtgagaaaaggagtgatcacgaagacatggatcaccgagaaaaaggtcatcttaac
tgcaaccggagacatgaatctgatgaagacagcttgggcagttctgcacggagaaatgct
gttctaaataaattgtccgagaccactaaaacaagttccaggaataaaagggtcagtgtg
gaaaaatggaatctctacaacgctgctcgggttcacattcacagaccctcctgcgttgcg
gtggaagttcagagactcaacgccctggaacttgaaaagaagattggaaaatccatcctg
gggaaggttcatctagccatggttcgttatcatgaagctggccgattttgcgaaaaagac
caggggtgggacgaagattcagcgctgtttcacctggagcatgcagctgagtgtggcgag
ctggaagccattgtagggctgggcctcatgcattctcagctacctcatcacatactttca
gaggtcacgctacaggacacaaagcaaaacagaatcaagggctttgaatatttgtgccaa
gcagcagaagctggagaccggccttccatgattcttgttgcgagagcttacgataccggt
gtgaacctggcgccagacagacagcaggattggaaagaagccttgtattggtacgacaaa
gctttgaacatgaccgattatgatgaagggggcgagtacgatggcacccaggatgagcct
cgctatctcctccttgcaaaagaggcagagatgctgatgctgggaggatttaatttggac
aaggatccgcagagatcaggagatctgtacacggaagctgctgaagctgctatccaagct
atgaaagggagactagctaaccagtactatcagaaagctgaagaagtttgggccatgatg
gaggactga

DBGET integrated database retrieval system