KEGG   Python bivittatus (Burmese python): 103063410Help
Entry
103063410         CDS       T03091                                 

Gene name
SRD5A3
Definition
steroid 5 alpha-reductase 3
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    103063410 (SRD5A3)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     103063410 (SRD5A3)
    1.3.1.94  polyprenol reductase
     103063410 (SRD5A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 315 aa AA seqDB search
MLAGVWLGLSAGFFAALLALRAPLLKAPPGVLSLSLAGLFQDLIRYGKTKTACGQRPAFL
QTFDVPKRWFYHFYIVSVTWNGFLLLLFIQRVLFSQPFPIWLQDLLGILDGTKGDRVIHH
SGNGAEFLSAFLVCLLVWVNSCRRLKECLHISIYSGGVIHFVQYCFGLFYYVLVGLTVLC
QVPAKNRDGKDHSLIVCWYHVLGLLMFCWASVHQHRCHIILANLRKDSSGKVFTMDHSIP
FDDWFEMVSCPHYFAEFLIYISMAVTFGFYNLTWWLVVTYVFFNQALSAVLCHEYYLNKF
KHYPKCRKAYIPFIF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgttggccggggtgtggctgggtctgtccgccggtttcttcgccgcgctgctagctttg
cgggcgccgctgctgaaagcaccgccgggggttctctcgctcagcctcgccgggctcttt
caggacctgatccggtacggaaagaccaagaccgcctgtgggcagcgccctgcctttctg
cagacctttgatgtccccaagaggtggttctaccatttttatattgtgtctgtgacctgg
aacggcttcctgctactgctgtttatccagcgtgtgcttttctctcagccattccccatt
tggcttcaggacttgcttggcattcttgatggaacgaagggagacagagttatccaccat
tcagggaatggtgccgagttcctgtcagccttcctggtatgccttttggtctgggtgaat
agctgtagacggttaaaagaatgtcttcacattagcatctattctggaggtgtcattcat
tttgtccagtactgctttggccttttttactatgttttggtggggcttacagtgctgtgt
caagtgccagcaaagaatagagatgggaaagatcactcgctgatagtctgctggtaccat
gttctaggacttctgatgttctgttgggcttctgttcatcaacacagatgtcatataatt
cttgctaatcttcgaaaagatagctcaggaaaagttttcaccatggatcacagcattccc
tttgatgactggtttgaaatggtgtcctgtcctcattattttgcagaatttctcatatat
atctcaatggctgtcacgtttggattttacaatttaacttggtggctagtggtgacatat
gtcttttttaaccaggcactaagtgctgttttgtgccacgaatattacttaaacaaattt
aagcactatccaaaatgccggaaagcatatataccctttattttttaa

DBGET integrated database retrieval system