KEGG   Python bivittatus (Burmese python): 103063694Help
Entry
103063694         CDS       T03091                                 

Gene name
GBA2
Definition
(RefSeq) glucosylceramidase beta 2
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00511  Other glycan degradation
pbi00600  Sphingolipid metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    103063694 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103063694 (GBA2)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103063694 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N DUF2063 Bac_rhamnosid6H
Motif
Other DBs
NCBI-GeneID: 103063694
NCBI-ProteinID: XP_007443396
Position
Un
AA seq 625 aa AA seqDB search
MFTFQNGMETKEDRRGGHWNEPFSLEKEGCCVRGVMLHHVTPVNPYTLAISAREKAGVTV
THFTAFNPAGTGQEVWQDLLADGRLASPPGQSPPTEKGEACAAAVCATRVVAGHGHGVLE
LGLAWDMPCIRFGSREKEHHRWYTRFFGRDGDACPALSHHLLSRYKEWEERIEAWQEPIL
GNSDLPPWYKSALFNELYFLADGGTLWVELLPEDRAALHGAQGLSQLLPVLQEYGRFAYL
EGQEYRMYNTYDVHFYASFALAMLWPKLELSLQYDMAAAVLNEDARTRQYLMSGQMAPVK
LRNVVPHDVGEPDDEPWQRVNAYLIHDTAAWKDLNLKFVLQVYRDYYLMQETAFLRDMWP
VCQAVMDSELKFDTDGDGLIENSGFADQTYDAWVATGASAYCGGLWLAAVCMMCRMAEVL
RDGEALERYSAILAKGAAAFERLLWNGKYYNYDSGRSPSSDSIMSDQLAGQWFLRACGLG
EGRSEVFPRSHVLSALKTIFELNVLGFSGGAMGAVNGMRPSGLPDTSSLQSDEVWVGVVY
ALAATMIQEGLVQEGFRTAEGCYRTVWERLGMAFQTPEAYCERRVFRSLAYMRPLSVWSM
QLALEQRVAQGHPIPAQPVASSVHP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccttccaaaacggcatggagaccaaggaggaccggcgaggcgggcactggaat
gagcccttcagcctggagaaggagggctgctgcgtccgtggcgtgatgctgcaccacgtt
actcctgtgaacccctataccctggccatctctgcccgggaaaaggcaggcgtcaccgtt
acccatttcacagccttcaaccctgctggcacgggacaggaggtttggcaggatctcctg
gcagatggccggctggcatctcctccaggtcagagtccccccacagagaagggggaggct
tgtgcagcagcagtttgtgccacacgcgtggtggcaggccatggtcacggagtgctggag
ctgggcctggcctgggacatgccttgcattcgctttggatctagggagaaggagcatcat
cggtggtacacgcgcttctttggcagggacggggatgcctgtccagcgctctcccatcat
ctgctcagccgctacaaggagtgggaggagaggatcgaggcctggcaggagcccatcttg
gggaacagcgacctgcccccttggtacaagtcagccctcttcaacgagctgtatttcctg
gctgacggaggcaccctgtgggtggaactgttgcccgaggacagggctgcgctgcacggc
gcccagggcctctcccagctgcttccggtcttgcaagagtatgggaggtttgcttatctg
gaaggccaggagtaccggatgtacaatacttacgacgtccatttctacgcctcctttgct
cttgccatgctgtggcccaagctggagcttagcctgcagtatgacatggctgccgctgtg
ctgaacgaggatgcgcgcactcggcagtacctcatgagcgggcagatggccccggtgaag
ctgcgcaacgtggttccgcatgacgtcggagagccagacgatgagccctggcagcgggtc
aacgcctacctgatacacgacacggctgcctggaaggacctcaacctgaagtttgtgctg
caggtctaccgggactactacctcatgcaggagacggccttcttgcgggacatgtggcct
gtctgccaggccgtgatggactcggaactgaagttcgacaccgacggcgacggcctcatt
gagaactcaggctttgctgaccaaacgtacgacgcctgggtggcgaccggggccagcgcc
tactgtggcggcctctggctggcggccgtttgcatgatgtgccgcatggccgaggtcttg
agggacggggaggccttggagagatactcagctatcctggccaagggcgctgcggcgttt
gagaggctgctctggaacgggaaatactacaactacgacagcggccgcagcccttcttcg
gacagcatcatgtcggaccagctggccgggcagtggttcctgcgggcatgtgggctgggc
gaagggcggtccgaggtgttcccccgcagccacgtgctcagtgccttgaagaccatcttc
gagctgaacgtgctgggcttttcgggaggggccatgggggccgtgaatggcatgcgcccc
tcagggctgccggacacctccagcttgcagtcggacgaggtgtgggtcggcgtggtgtac
gccctggctgccaccatgatccaggagggtctcgtgcaagagggcttccgcaccgccgaa
ggttgctaccggaccgtttgggagcggctggggatggctttccagacccccgaggcgtac
tgcgagaggagggtcttccgctcactggcctacatgcgccccctcagcgtctggagtatg
cagctggccttggagcagcgggtggcacaagggcaccccatcccagctcagcctgtggcc
agttcggttcacccctga

DBGET integrated database retrieval system