KEGG   Python bivittatus (Burmese python): 103066701Help
Entry
103066701         CDS       T03091                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
pbi  Python bivittatus (Burmese python)
Brite
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103066701
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S33
   103066701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 322 aa AA seqDB search
MEVTPKYASFTKSPSPSHTVLPTFRSKHLKTGVKVKYLDKEGYRFSYFTRGEPGCQPSVL
MLHGFSLNKDMWLNIIQDFPKDLHLICLDLPGHGGTTCLLAESHTADAQAKRLHQFVECA
GLNHKPFHLVGMSTGGMVAGVYAALYPSHVSSLALLCPAGLKIPKQSELFVWLQKLVFSK
EPADNALVSVTEQETENIIKLCLYQPSFLKMQFLKRYLADRRPHKMFFVMCFLDLTSTES
KYSLHDNMKKIKAPTQIIWGKEDKVFDSLGAEILAAAIPNSQVHRLEKCGHFIALERPRT
SARLLLEFYKSVCDSAKHKKVA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcactccaaaatatgcctccttcacaaaatccccatcaccctcccatactgtt
ctccctactttcaggagcaagcatctgaaaacgggtgtgaaagtgaagtacctcgataag
gagggctaccggttcagctacttcacccgaggggagcccggatgccagccatctgtgctg
atgcttcatggattctcactcaacaaagacatgtggttaaatatcatccaagactttcct
aaggacctccacttgatctgccttgatctgccaggtcatgggggcaccacttgcttgctg
gcagaaagtcacacagcagatgctcaggctaaaaggctacaccagtttgtcgagtgtgct
ggcctgaaccacaaacctttccacctggttggcatgtccacgggaggcatggttgctggg
gtttacgcagctctctatccaagccacgtctcctccttagccctcctttgcccagctggt
ctcaagattccaaaacaaagtgagctgtttgtttggttacaaaagctagttttctctaag
gaacctgctgacaatgctcttgtttcagttaccgagcaagaaacagaaaacatcattaaa
ctttgcttataccaacccagctttttaaagatgcagttcctaaagagataccttgcggat
cgaagaccacataagatgttttttgtaatgtgttttctggacctcaccagtactgagtcg
aagtacagcctccatgacaacatgaagaaaatcaaagctcccacccagatcatttgggga
aaggaggacaaggtctttgactctttgggtgcagaaatcttggcagctgccattcctaat
tcccaagtgcatcggctagaaaaatgtggacatttcatagccctcgagaggcccaggaca
tccgcgcggctcctcttggaattctacaaatcggtctgtgactcagccaagcataagaag
gtggcctga

DBGET integrated database retrieval system