KEGG   Paracoccidioides brasiliensis: PAAG_00024Help
Entry
PAAG_00024        CDS       T02230                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAAG_00024
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAAG_00024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1516 aa AA seqDB search
MAASEDMSGSSPHPHGADDVSENGRQELQSAPAVKRPAAEMGEDDRQPQDVEMGAAPSGG
NEEKEVLSSYNPVPKSKKQTDRPTRHRRAVSVDMEGQDDDSMEVKHENPKSASSEDTVSS
SSDSVYPTPSSMSTYTSSTREDYKPSHTQPRASHDMPSIDDQVAIVTKLLLQPLKENQKG
YVVSANWLGRVLSRSSKGGLPREKIDKTASEGEIGPVDNSDLVLVTDPSLSYKDEAGELF
VPLRPGLQIGEDFEVLPEDAWEMIMKWYGLSRDSPAIVRFAHDTATGTTENVQYELNPPI
FTILKLPNPSQSQAQIAQDKARAPVKTLASRHTPFQQWLRNVKSLASIEMSTKVRVWRIL
EGLNSTATSGIITPAASRSTSPAPGATLTANAGNSLVLDVNKFVALVEGSQRELLEMKDQ
TANLKYNGSLTLHLAGLGGDDVIVLEEQVGGPGGGEWVADCAGKNANHLSVTAIKAGSQN
KAKAKAPATSGRASSPAVGPVTRGRQRKDGRSRGVTGLSNLGNSCYMNSALQCVRSVEEL
TQYFLQDEYRKDLNPGNPLSHDGNVAKAYANLLHQLFDENGTSSFAPRQFKQTIGRYGPS
FSGYGQQDSQEFVLFLLDGLQEDLNRIQKKPYIEKPDSTDDMVNDNAALQQFASKCWDIY
KARNDSVITDLFAGMYKSTVVCPVCDKVSIIFDPFSNLTLQLPIENLWSKELFFFPLYSR
PVRLDVDIDKNSSVKALKEYVGEKVNVDTSRLVMAEIYKQKFYKMFDNTSSIADCQISAS
DDIGIFEVESVPTSYDPDKPPKRSSYSSLVFTSSSADQDIPPFDSPKCDRMLIPVFHRTI
KSQGARISRQLFGAPSYIVVNREEAYDYDSILRKVLRNSANLTSRDFLREDDGDAVMSSS
PAEDSDTVVTNDDDFDSSDPKIKVSSVDGEDGLVDVSMRDASDPSSQIKSKPRNNPVTIP
KVLRPGSFIPPNLRKLFEIKIMRSTDAVPTGFSSVDEIKDFTSMASRLPRKQSKRVHAKK
KFASRGNSPISSEDELSGPARRVNSARSKDGHDSDDSGSQETKDDSGTESGTDSYPHNAT
LLHKFGREKPKTSAVRNGPQRPIPLIRAGEGIILEWNEHAFDALFAGDPREEDSLRGSPT
WMNIDCVPDPELAEKRQLRQSRKKRGVSLDECLDEFGKEEILSENDAWYCPRCKEHRRAS
KKFELWKCPDILVMHLKRFSANRGFRDKIDALVDFPHELDMTGRVQMPEEGKSLQYELIA
VDNHYGGLGGGHYTAFAKNFFDGCWYEYNDSHVSKKTNPSAVVTSAAYLLFYRRRSDVPL
GGEYLANVTRMANNQDQADSDSQTDSRQPSPSGEGQRLGGSSRSGSSSALTGAAAIHQAG
DGGLRGGIQARDDDDLPEYFEHGLDGTSRNHLEDMDLEDEGFDASFGPELNFSNHPIWSF
DRAEVPYGPSGLVSAPANSFYDGDGDEDLDDDASNKAVGGGDMSDSESRLAMLNDSDEPG
MVFDDLDPTTVQNITH
NT seq 4551 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctgaagacatgtcgggctcgtctcctcatcctcatggagcggatgatgtc
tctgagaatggtcgacaagaattgcagtctgcccccgccgtaaagcggcctgctgctgaa
atgggtgaggacgaccgccaacctcaagatgtcgaaatgggggccgctccgtctggtggc
aatgaggagaaggaagtcttgtcatcctacaaccctgttcctaagagcaagaagcagacg
gatcgaccaacgaggcatcgtagagctgtatctgtggatatggaaggacaggatgatgat
tccatggaggtaaaacatgagaacccaaagtctgcttcttccgaagacacagttagctcg
tcttcggatagcgtctatcccacaccatccagcatgtcgacatatacctcatccacacgc
gaagattacaaaccatcccatactcagcctcgtgccagtcatgacatgccgtcaatcgac
gaccaggtcgccattgtaaccaaactgctgctgcaaccgctgaaggagaaccagaaggga
tatgtggtttctgcgaactggctaggccgtgtcctttcgaggagttccaaaggaggctta
ccacgggagaaaatcgataaaactgcttcagaaggagaaattggtcctgtcgacaactca
gatcttgttttggttacggatccttccctctcatacaaagatgaggctggcgagctattc
gttcccttacgacctggcttgcagatcggagaggacttcgaagtgctaccagaagacgcc
tgggaaatgatcatgaaatggtacggcctctcaagagactctcctgccattgttcgattc
gctcatgacaccgccacgggaactacggaaaatgtccagtatgagcttaaccctccaatt
tttaccattttgaaattaccaaacccttcccaatcccaggctcagatcgcccaggacaaa
gctcgtgctcctgtaaaaactctggctagcagacacacaccgtttcagcagtggttacgg
aacgtgaaaagcttggcatctatcgaaatgtctacaaaagtccgtgtctggagaattctc
gaagggctgaacagcaccgcaacgtctggtatcatcacccctgcggcatccagaagcacc
tcccctgcccctggcgccacattgaccgccaacgctggcaacagccttgtgctggacgtg
aacaaattcgttgctcttgtcgaaggctctcagcgtgaactacttgaaatgaaggaccaa
acagccaatctaaaatataacggcagccttacattgcaccttgccggcctgggaggcgac
gatgtcattgtgctagaagaacaagttggtggtcctggtggcggagagtgggttgctgat
tgcgctggcaaaaacgcaaatcatctttctgttactgcaatcaaggccggctcccaaaac
aaggctaaggccaaagctcccgctaccagcggtcgagcctcatcacctgctgttgggccc
gttactaggggacggcagcgtaaagacggccgctctcgtggcgtcactggcttgagcaat
cttggaaatagttgctatatgaactccgctttacagtgtgttcggagtgtagaagaattg
actcaatatttcctccaggatgaatacaggaaggaccttaatccaggcaatccactttct
catgatgggaatgttgctaaggcttatgcaaatctgttgcatcaactgtttgatgaaaat
ggaacctcctcttttgctccccgtcaatttaagcaaacgatcggaagatatggtccttcg
ttctctggatatggccagcaagattctcaggagtttgtgcttttccttctggacgggttg
caggaggatttgaataggattcaaaagaagccgtatatcgaaaaaccagattctactgat
gatatggttaacgacaatgctgcactgcaacaatttgctagcaaatgctgggatatctac
aaggcacggaatgactcggtaattactgaccttttcgcaggaatgtacaagtccactgtg
gtctgtcccgtttgtgataaagttagcataattttcgatccatttagcaatctcaccttg
caactcccgattgaaaacctttggagcaaagaattgtttttcttccctctttattcccgc
cccgttcgattggatgttgacatcgacaaaaactccagtgtcaaggctttgaaagaatat
gtgggggaaaaagttaacgtcgataccagcagacttgttatggctgagatctacaaacaa
aagttctataaaatgtttgataatacatcaagcattgccgattgtcagattagtgcatcg
gatgatatcggtattttcgaagttgaatccgtaccaactagttacgacccagataaaccc
cccaaacgatcttcctactccagccttgtcttcaccagtagctccgctgaccaagatatt
ccaccttttgactccccaaaatgcgataggatgctcatccccgttttccaccgtaccatc
aaatcgcaaggcgctaggatttcacggcaactattcggtgctccttcatatattgtggtt
aaccgcgaagaggcatatgattatgatagcatactgcgtaaagttctgcgaaactcggca
aatctaacaagtcgagatttcctccgtgaagatgatggagatgctgtcatgagctctagt
ccagctgaggattccgatactgtcgttaccaatgacgatgactttgactcctccgatccc
aagataaaggtgtcttccgttgacggggaggacggtctagttgatgtatcgatgcgggat
gcttccgatccatcaagtcaaattaaatcgaaacccagaaataatcctgttactattccg
aaagttcttcggccaggtagcttcatcccgcctaatcttcgcaaattattcgagataaaa
atcatgcgatctaccgatgctgttcccaccggattttcctccgttgacgaaatcaaagac
ttcacttcgatggcctccagactgcccaggaagcagagcaaacgtgtccatgcaaagaag
aagtttgccagccgtggaaacagccctattagtagcgaggacgaactcagtggtcctgct
cgccgcgttaatagcgctcgctcgaaagatggtcatgattcagacgactctggctctcag
gagaccaaggacgatagcggcacagagagtggcacagactcttacccacacaatgcgact
ctcctacacaagtttggacgtgagaagcccaagacatcggcagtccgtaacggaccacag
agacccattcccctgatacgtgccggagagggtattattctggagtggaatgaacacgca
ttcgacgctctcttcgcaggtgatccgcgtgaagaggactccctgcgaggatccccaaca
tggatgaatatcgattgcgttcccgacccggaactagctgagaaacgtcaattgcgtcaa
tcccggaaaaagcgcggggttagtctggatgagtgtttggatgaattcggcaaggaggag
attctctccgagaatgacgcctggtactgtccccgttgcaaagagcaccgtcgcgcgtcg
aagaaatttgagctgtggaagtgtccagatatattggtgatgcatctgaaacgctttagc
gccaatagagggttccgggataagattgacgcactagttgatttcccgcatgagttggat
atgactggccgggtgcaaatgcctgaggagggcaagagcttgcagtatgagttgatcgct
gtcgataatcattacggcggccttggtggtgggcattatactgcgttcgccaagaacttt
tttgatgggtgttggtatgaatacaatgactcccacgtttcgaagaaaacaaacccttct
gcagtggttacctctgccgcataccttctattctatcgccgtcgttctgacgtcccttta
ggcggagaatatctcgccaatgtcaccagaatggcgaacaaccaagaccaagccgactct
gattcacagaccgactcccgacagccctccccttcgggggaaggccagcgcctcggtggc
tcctcccgcagtgggtcgtcgagcgctttaaccggagccgcagcaattcaccaagcggga
gatggtggtttgcggggcggaatccaagcgagggatgatgacgacctcccagagtacttc
gagcatggcctagatggcaccagccggaaccatctagaagacatggatctggaagatgaa
gggttcgacgcaagctttggcccagagctgaatttctccaaccacccaatctggtcattt
gaccgtgcagaggtcccgtatggaccgtcaggtctcgtttccgcgcccgccaactccttc
tacgacggcgacggtgatgaggatctagatgacgatgctagcaacaaggccgtcggcggt
ggcgacatgagcgattcggaatcacggctagcgatgctgaatgactccgatgagccgggg
atggtctttgacgatctagatccgactacggtacagaatattacgcattag

DBGET integrated database retrieval system