KEGG   Paracoccidioides lutzii Pb01: PAAG_11034Help
Entry
PAAG_11034        CDS       T02230                                 

Gene name
PAAG_00050
Definition
(RefSeq) hypothetical protein
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 56 aa AA seqDB search
MAASVMSRSASCRSLFSRSPSICIRESGHMYRLRDASRRKLPALAALARFYASKCK
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttccgtcatgtcgcggtctgcttcttgccgctccttgttctccagaagccct
tccatctgcatacgggaatcagggcatatgtatcggctgcgtgatgcttcccgacggaag
ttgccagcattggcagcccttgcccgattctatgcctccaaatgcaagtag

DBGET integrated database retrieval system