KEGG   Paracoccidioides brasiliensis: PAAG_00050Help
Entry
PAAG_00050        CDS       T02230                                 

Definition
pyruvate dehydrogenase protein X component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_00050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_00050
   00020 Citrate cycle (TCA cycle)
    PAAG_00050
   00620 Pyruvate metabolism
    PAAG_00050
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAAG_00050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 489 aa AA seqDB search
MAASVMSRSASCRSLFSRSPSICIRESGHMYRLRDASRRKLPALAALARFYASKSYPPHT
IISMPALSPTMTAGNIGAWQKKVGDALAPGDVLVEIETDKAQMDFEFQEGGVLARILREA
GEKDIAVGNPIAVMVEEGTDITPFESFSLEDAGGEKSSALKEPEQPKKELKVAPAAPKEE
STPAAEEEPVSTGERLQPSLDRESFIAPAVKALALERGVPLKDIKGTGPGGRVTKNDVEK
YQPAGTAVSASGPAFEDIPASSMRKIIANRLVQSMRENPHYFVTSNLSVTKLLKLREALN
NSADGKYKLSVNDFLVKACAAALLKVPAVNSSWVEENGQVVIRQHKTADISVAVATSVGL
ITPIVRNAHTLGLSSISSQVKDLGKRARENKLKPEEYIGGTFTISNMGMNHAVERFTAVI
NPPQSAILAVGTTQKVAIPVEGEDGTSVKWDDQIVVTASFDHKIVDGAVGAEWMRELKQI
VENPLELLL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttccgtcatgtcgcggtctgcttcttgccgctccttgttctccagaagccct
tccatctgcatacgggaatcagggcatatgtatcggctgcgtgatgcttcccgacggaag
ttgccagcattggcagcccttgcccgattctatgcctccaaatcttatcctccacataca
ataattagcatgcccgcgctctccccaacaatgactgccggcaacatcggggcttggcag
aaaaaagtcggggatgcccttgctcccggtgatgttctggtggagatcgaaacagacaaa
gctcagatggatttcgaattccaggaaggaggagtcttggcaaggattttgagggaggct
ggtgagaaggatatcgctgtaggaaatccaattgcagtcatggtggaagaaggcacagat
atcacaccattcgagtcgttctcattggaggatgctggtggtgagaagtcctccgctctg
aaggagccagagcagcccaagaaggagctcaaagttgctccagctgcaccaaaggaggaa
tcgaccccagcagctgaggaggagcctgtatcaacgggagagagattacaacctagcctg
gacagagagtcatttattgcccccgcagtaaaagctctagccttagaacggggtgtgccc
ttgaaagacatcaagggaacaggtcctggtgggcgggttactaagaacgatgttgagaag
taccaacccgccggtacggctgtcagtgcatctggtccagccttcgaggatattcccgca
tcttccatgcgtaagatcattgccaaccgtctagtgcaatccatgcgagaaaatccccac
tacttcgtgacttcgaacctctccgtcactaaactgctgaagctgcgcgaggctctcaat
aactccgctgacggaaaatataagctttctgtaaatgacttcctcgtcaaagcctgcgcg
gctgctctgcttaaggtgccagccgtaaactcgagctgggttgaggagaacggacaggtc
gtcatccgccaacacaagacagcggatatcagcgtcgccgtcgccacatccgtcggcctc
atcacgcccattgtacgaaacgcgcacaccctcggtctctccagcatctccagccaggtc
aaagaccttggcaagcgcgcacgcgagaacaaattgaaaccggaggaatacattggcgga
accttcaccatcagcaacatgggcatgaaccatgccgtggagcgatttaccgcagtcatc
aatcctcctcaatccgccattttagccgttggcacgacgcagaaagtcgctatccccgtg
gagggtgaagatggcacttctgtcaaatgggatgaccagattgtcgtgacggccagtttc
gaccacaaaatcgttgacggagcagttggcgctgagtggatgagggagttgaagcagata
gttgagaaccctctcgagcttctcctttaa

DBGET integrated database retrieval system