KEGG   Paracoccidioides brasiliensis: PAAG_00106Help
Entry
PAAG_00106        CDS       T02230                                 

Definition
histone acetyltransferase type B catalytic subunit
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_00106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 546 aa AA seqDB search
MESQSPWSCDANDAIQISIVQPGQDKLATLSTFQPEFTYPIFGEEETIFGYKGLIIRLRF
AAHDLRSNVHISYDEKFKTVADVAPVDLLKILNPWLPKSSFAPLEDFEESVLNDKFAKDF
KPPGKLVHSYTSKQRNYEIWAGPLTDPEIRTILDRVQIFVSFFIEGGTPITTDDFEWTLQ
RWTVYLIYEKRDPPNPTASPYSFVGYSTTYRWYFYLEDPNNDNKIRHTAKILDTPFPYTD
GISISQLPARLRISQFLILQPHQQSGHGSQLYHTIQSACLTDPTLHELTVEDPNEAFDYL
RDINDYHTLYPEFLKHKISINPNPYQPDDQAQQGAPRRRRPRLMPTSALLPTTTLRDLRI
RYKIAPVQFSHIVEMYLLSQIPADHRGASNTNIARLLVQKWRAPNEHDRRYYWWRMLVKQ
RLYKRHRDLLIQLDRDERLQKLEETLGNVEEGYDGLLKAFGVKRGGGQRGGKEDGDKGEG
ERDGEGEGEGENGDAEGSGDWERGKRKFTVLEDEDEEGEDGGGEGKDGENGATDGEDMPS
AKKLKT
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggagagccagtccccttggtcttgcgatgcaaacgatgctattcagatatccattgtc
caacccggccaagacaagctagctactctctccactttccagcccgagttcacatatcca
attttcggtgaagaggaaaccatatttggctacaaaggattgatcattcgactgcgtttt
gctgcgcatgatctcagatcaaatgtgcatatctcatatgatgaaaaattcaagacagtt
gccgacgttgctcccgtggatctattgaagatactgaatccctggctgccgaagtcttcg
tttgcgcctctggaggactttgaagaatcggttctaaacgataaatttgcgaaagacttc
aaaccaccaggaaagcttgtccatagctacacaagcaagcagaggaattatgagatatgg
gccggtccgttaaccgatcccgaaattcggactattctcgatcgcgtacaaatattcgtc
tctttcttcatcgaagggggtaccccaatcacaacggacgattttgaatggaccctccaa
aggtggacagtatacctcatttacgaaaagagggatcctcccaatcctacagcctcacca
tactcattcgtaggctactcaaccacataccgatggtatttttacctcgaagaccccaac
aacgacaataaaatacgtcacacggcaaaaatcttagacacccccttcccctacacagat
ggaatctccatctcccaactccccgcccgcctccgcatttcccaattcctcatcctccaa
ccccaccagcaatccggtcacggctcccagctctaccacacaatccaatccgcctgccta
actgaccccacccttcacgaactcaccgtcgaagaccctaacgaagctttcgattacctc
cgcgacataaatgactaccacaccctctaccccgaattcctcaaacacaagatatccata
aacccaaacccgtaccaaccagacgaccaggcacaacagggagctccacgccgccgtcgg
ccccgccttatgcctacctccgccctcctcccaacaaccactctccgcgacctgcgaatc
cgctacaagatcgcccccgtgcaattctcacatatagtcgaaatgtacctcctaagccaa
atcccagcagaccatcgcggcgccagcaatacgaacatagcgcgcctgcttgtgcagaaa
tggcgcgcacccaacgagcatgataggcggtattactggtggcgcatgctggttaagcag
cggctgtataagcggcatcgtgacttgttgattcagctggatcgcgacgaaagattgcag
aaactggaggagacgttgggaaatgtggaggaggggtatgatgggttgcttaaggcgttt
ggggttaagaggggtggtgggcagaggggtggaaaagaagatggagataagggtgagggg
gagagggatggggaaggggaaggggaaggagagaatggtgatgcagaagggagcggggat
tgggagagggggaagaggaaattcactgttctcgaagatgaggatgaagagggagaagat
ggtggaggggaagggaaagacggggagaatggggcgacagatggagaggacatgccttcc
gcgaagaaattgaagacttga

DBGET integrated database retrieval system