KEGG   Paracoccidioides lutzii Pb01: PAAG_00106Help
Entry
PAAG_00106        CDS       T02230                                 

Definition
(RefSeq) histone acetyltransferase type B catalytic subunit
  KO
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_00106
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PAAG_00106
   HAT complexes
    HATB complex
     PAAG_00106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 555 aa AA seqDB search
MNELTHWLMLDLRYLGSCDANDAIQISIVQPGQDKLATLSTFQPEFTYPIFGEEETIFGY
KGLIIRLRFAAHDLRSNVHISYDEKFKTVADVAPVDLLKILNPWLPKSSFAPLEDFEESV
LNDKFAKDFKPPGKLVHSYTSKQRNYEIWAGPLTDPEIRTILDRVQIFVSFFIEGGTPIT
TDDFEWTLQRWTVYLIYEKRDPPNPTASPYSFVGYSTTYRWYFYLEDPNNDNKIRHTAKI
LDTPFPYTDGISISQLPARLRISQFLILQPHQQSGHGSQLYHTIQSACLTDPTLHELTVE
DPNEAFDYLRDINDYHTLYPEFLKHKISINPNPYQPDDQAQQGAPRRRRPRLMPTSALLP
TTTLRDLRIRYKIAPVQFSHIVEMYLLSQIPADHRGASNTNIARLLVQKWRAPNEHDRRY
YWWRMLVKQRLYKRHRDLLIQLDRDERLQKLEETLGNVEEGYDGLLKAFGVKRGGGQRGG
KEDGDKGEGERDGEGEGEGENGDAEGSGDWERGKRKFTVLEDEDEEGEDGGGEGKDGENG
ATDGEDMPSAKKLKT
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagctcacccactggctgatgcttgatttgcgatacctagggtcttgcgatgca
aacgatgctattcagatatccattgtccaacccggccaagacaagctagctactctctcc
actttccagcccgagttcacatatccaattttcggtgaagaggaaaccatatttggctac
aaaggattgatcattcgactgcgttttgctgcgcatgatctcagatcaaatgtgcatatc
tcatatgatgaaaaattcaagacagttgccgacgttgctcccgtggatctattgaagata
ctgaatccctggctgccgaagtcttcgtttgcgcctctggaggactttgaagaatcggtt
ctaaacgataaatttgcgaaagacttcaaaccaccaggaaagcttgtccatagctacaca
agcaagcagaggaattatgagatatgggccggtccgttaaccgatcccgaaattcggact
attctcgatcgcgtacaaatattcgtctctttcttcatcgaagggggtaccccaatcaca
acggacgattttgaatggaccctccaaaggtggacagtatacctcatttacgaaaagagg
gatcctcccaatcctacagcctcaccatactcattcgtaggctactcaaccacataccga
tggtatttttacctcgaagaccccaacaacgacaataaaatacgtcacacggcaaaaatc
ttagacacccccttcccctacacagatggaatctccatctcccaactccccgcccgcctc
cgcatttcccaattcctcatcctccaaccccaccagcaatccggtcacggctcccagctc
taccacacaatccaatccgcctgcctaactgaccccacccttcacgaactcaccgtcgaa
gaccctaacgaagctttcgattacctccgcgacataaatgactaccacaccctctacccc
gaattcctcaaacacaagatatccataaacccaaacccgtaccaaccagacgaccaggca
caacagggagctccacgccgccgtcggccccgccttatgcctacctccgccctcctccca
acaaccactctccgcgacctgcgaatccgctacaagatcgcccccgtgcaattctcacat
atagtcgaaatgtacctcctaagccaaatcccagcagaccatcgcggcgccagcaatacg
aacatagcgcgcctgcttgtgcagaaatggcgcgcacccaacgagcatgataggcggtat
tactggtggcgcatgctggttaagcagcggctgtataagcggcatcgtgacttgttgatt
cagctggatcgcgacgaaagattgcagaaactggaggagacgttgggaaatgtggaggag
gggtatgatgggttgcttaaggcgtttggggttaagaggggtggtgggcagaggggtgga
aaagaagatggagataagggtgagggggagagggatggggaaggggaaggggaaggagag
aatggtgatgcagaagggagcggggattgggagagggggaagaggaaattcactgttctc
gaagatgaggatgaagagggagaagatggtggaggggaagggaaagacggggagaatggg
gcgacagatggagaggacatgccttccgcgaagaaattgaagacttga

DBGET integrated database retrieval system