KEGG   Paracoccidioides brasiliensis: PAAG_00108Help
Entry
PAAG_00108        CDS       T02230                                 

Definition
cAMP-dependent protein kinase catalytic subunit pkaC
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PAAG_00108
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PAAG_00108
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PAAG_00108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 371 aa AA seqDB search
MHSQHSQQQQQQQQQQQQQQQQQQQQQQQIQQSVPSVSRQTKGKYSLDDFTLQRTLGTGS
FGRVHLVQSRHNQRFYAIKVLKKAQVVKMKQVEHTNDERKMLQRVKHPFLITLWGTFQDV
KNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHDHHIVYRDLKPENLL
LDRYGHLKITDFGFAKEVKDITWTLCGTPDYLAPEVVSSKGYNMSVDWWSLGILIFEMLC
GFTPFWDGGSPMKIYENIIKCRVKYPSYMHPDAQDLLSQLITPDLTVRLGNLHGGSQDVK
NHPWFAEVTWDRLARKDIDAPYIPPVKGGQGDASQFDRYPEETEPYGGSGDDPYVSPFLL
FLSFVSTTKLY
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcattcacagcattcacagcaacaacaacaacaacagcaacaacagcagcagcagcag
caacagcagcaacagcagcaacaacaaattcaacaatctgtcccgtcagtttcgcggcag
acaaagggcaaatactcgctagatgactttacgttgcaacggacgttggggacgggcagt
ttcgggcgagtacacctggttcaatcacgacataaccagcgcttctatgccatcaaggtg
ctgaagaaagcgcaagtggtgaagatgaagcaggtcgagcatacgaatgatgaacgaaaa
atgctgcagcgggttaagcatccattcctaattacgttgtggggcacgttccaggatgtg
aagaatctttatatggttatggattttgtggagggtggggagctgtttagtttactgagg
aaatcgcagcgcttcccaaatcctgttgcgaaattctacgctgcggaggttacgttggcg
ttggaatatctacatgaccatcacattgtatacagagacctaaagccagagaatctactt
ttagatcgatatggacatttgaagattacagattttggattcgcgaaggaagtcaaggat
attacatggactttatgcgggacaccagattatctggcgccggaggtagtttcgtcaaag
ggatacaatatgtccgttgactggtggtccctcggcatcctaatcttcgaaatgctctgc
ggcttcacccccttctgggacggcggcagccccatgaaaatctacgaaaacatcataaaa
tgccgagtcaagtacccgtcctacatgcacccggacgcccaagatctactctcccaactc
atcactcccgatctcacagttcgcctgggaaacttgcacggcggcagtcaggatgttaag
aatcatccgtggtttgcggaggtgacgtgggatcggctagcgcggaaggatattgatgcg
ccgtatattccgccggtgaagggagggcagggggatgcaagccagtttgataggtatccc
gaggagacggagccgtatgggggcagtggggatgatccgtatgtttcccctttcttgctt
ttcctctcgtttgtttcaactacgaagctttactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system