KEGG   Paracoccidioides lutzii Pb01: PAAG_00108Help
Entry
PAAG_00108        CDS       T02230                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit pkaC
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Meiosis - yeast
Autophagy - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Transport and catabolism
   04138 Autophagy - yeast
    PAAG_00108
  Cell growth and death
   04113 Meiosis - yeast
    PAAG_00108
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PAAG_00108
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PAAG_00108
Messenger RNA biogenesis [BR:pbl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PAAG_00108
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    PAAG_00108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 585 aa AA seqDB search
MRGLGNLLKKKKKRTKDSRISRDLDLSASPVAESTSSSPGDNNNNIIINISSPLSQTTAA
TATAPATVTEASTTNTLLQHPAFTSPARDSSCKDPASSPGTNKISSSSNPPASVFRTAIP
TSTEPEGVASSPPTGSTTAGAITKIDSTHSAPMNPLQSSGPPSSNIAGDPSHFKQHQQQQ
QQPQQQSHHSQNVASIKNIINPPLNDEVAASSQRVGDGLHAAQQMHSQHSQQQQQQQQQQ
QQQQQQQQQQQQQIQQSVPSVSRQTKGKYSLDDFTLQRTLGTGSFGRVHLVQSRHNQRFY
AIKVLKKAQVVKMKQVEHTNDERKMLQRVKHPFLITLWGTFQDVKNLYMVMDFVEGGELF
SLLRKSQRFPNPVAKFYAAEVTLALEYLHDHHIVYRDLKPENLLLDRYGHLKITDFGFAK
EVKDITWTLCGTPDYLAPEVVSSKGYNMSVDWWSLGILIFEMLCGFTPFWDGGSPMKIYE
NIIKCRVKYPSYMHPDAQDLLSQLITPDLTVRLGNLHGGSQDVKNHPWFAEVTWDRLARK
DIDAPYIPPVKGGQGDASQFDRYPEETEPYGGSGDDPYGNYFVDF
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtctaggcaatttgctgaagaagaagaagaagcggacgaaggactcgcgcatc
tcgagggacctggatctgtccgcttcaccggtagcggagtcaacctcgtcgtctcctggc
gataataataataatattattattaatattagtagccctctctcccagacgacagcagct
acagctaccgcaccagctaccgtaacagaagcatcaacaacgaacaccctgctccagcac
cctgcgtttacctcacccgcccgcgattcctcttgcaaagaccccgcttcctcccccggc
accaataagatcagtagcagtagtaatcctcctgcctccgtttttcgtacagctattcct
acctcgactgaaccagagggagtcgcctcctctcctcccacaggctccacaacagctggc
gcaattacgaaaattgacagcacacattctgcacccatgaaccccctacaatcttccggc
cccccttcctcgaatatagcgggcgatccctctcatttcaaacagcaccagcaacagcaa
cagcaaccacagcagcaatcccaccactcccaaaatgtcgccagtattaaaaacattata
aatccacccctcaacgatgaagttgcggcctcctcacaacgagttggcgatggcctacat
gccgcacaacaaatgcattcacagcattcacagcaacaacaacaacaacagcaacaacag
cagcagcagcagcaacagcagcaacagcagcaacaacaaattcaacaatctgtcccgtca
gtttcgcggcagacaaagggcaaatactcgctagatgactttacgttgcaacggacgttg
gggacgggcagtttcgggcgagtacacctggttcaatcacgacataaccagcgcttctat
gccatcaaggtgctgaagaaagcgcaagtggtgaagatgaagcaggtcgagcatacgaat
gatgaacgaaaaatgctgcagcgggttaagcatccattcctaattacgttgtggggcacg
ttccaggatgtgaagaatctttatatggttatggattttgtggagggtggggagctgttt
agtttactgaggaaatcgcagcgcttcccaaatcctgttgcgaaattctacgctgcggag
gttacgttggcgttggaatatctacatgaccatcacattgtatacagagacctaaagcca
gagaatctacttttagatcgatatggacatttgaagattacagattttggattcgcgaag
gaagtcaaggatattacatggactttatgcgggacaccagattatctggcgccggaggta
gtttcgtcaaagggatacaatatgtccgttgactggtggtccctcggcatcctaatcttc
gaaatgctctgcggcttcacccccttctgggacggcggcagccccatgaaaatctacgaa
aacatcataaaatgccgagtcaagtacccgtcctacatgcacccggacgcccaagatcta
ctctcccaactcatcactcccgatctcacagttcgcctgggaaacttgcacggcggcagt
caggatgttaagaatcatccgtggtttgcggaggtgacgtgggatcggctagcgcggaag
gatattgatgcgccgtatattccgccggtgaagggagggcagggggatgcaagccagttt
gataggtatcccgaggagacggagccgtatgggggcagtggggatgatccgtatggaaat
tatttcgtggacttttga

DBGET integrated database retrieval system