KEGG   Paracoccidioides lutzii Pb01: PAAG_00108Help
Entry
PAAG_00108        CDS       T02230                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit pkaC
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 585 aa AA seqDB search
MRGLGNLLKKKKKRTKDSRISRDLDLSASPVAESTSSSPGDNNNNIIINISSPLSQTTAA
TATAPATVTEASTTNTLLQHPAFTSPARDSSCKDPASSPGTNKISSSSNPPASVFRTAIP
TSTEPEGVASSPPTGSTTAGAITKIDSTHSAPMNPLQSSGPPSSNIAGDPSHFKQHQQQQ
QQPQQQSHHSQNVASIKNIINPPLNDEVAASSQRVGDGLHAAQQMHSQHSQQQQQQQQQQ
QQQQQQQQQQQQQIQQSVPSVSRQTKGKYSLDDFTLQRTLGTGSFGRVHLVQSRHNQRFY
AIKVLKKAQVVKMKQVEHTNDERKMLQRVKHPFLITLWGTFQDVKNLYMVMDFVEGGELF
SLLRKSQRFPNPVAKFYAAEVTLALEYLHDHHIVYRDLKPENLLLDRYGHLKITDFGFAK
EVKDITWTLCGTPDYLAPEVVSSKGYNMSVDWWSLGILIFEMLCGFTPFWDGGSPMKIYE
NIIKCRVKYPSYMHPDAQDLLSQLITPDLTVRLGNLHGGSQDVKNHPWFAEVTWDRLARK
DIDAPYIPPVKGGQGDASQFDRYPEETEPYGGSGDDPYGNYFVDF
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtctaggcaatttgctgaagaagaagaagaagcggacgaaggactcgcgcatc
tcgagggacctggatctgtccgcttcaccggtagcggagtcaacctcgtcgtctcctggc
gataataataataatattattattaatattagtagccctctctcccagacgacagcagct
acagctaccgcaccagctaccgtaacagaagcatcaacaacgaacaccctgctccagcac
cctgcgtttacctcacccgcccgcgattcctcttgcaaagaccccgcttcctcccccggc
accaataagatcagtagcagtagtaatcctcctgcctccgtttttcgtacagctattcct
acctcgactgaaccagagggagtcgcctcctctcctcccacaggctccacaacagctggc
gcaattacgaaaattgacagcacacattctgcacccatgaaccccctacaatcttccggc
cccccttcctcgaatatagcgggcgatccctctcatttcaaacagcaccagcaacagcaa
cagcaaccacagcagcaatcccaccactcccaaaatgtcgccagtattaaaaacattata
aatccacccctcaacgatgaagttgcggcctcctcacaacgagttggcgatggcctacat
gccgcacaacaaatgcattcacagcattcacagcaacaacaacaacaacagcaacaacag
cagcagcagcagcaacagcagcaacagcagcaacaacaaattcaacaatctgtcccgtca
gtttcgcggcagacaaagggcaaatactcgctagatgactttacgttgcaacggacgttg
gggacgggcagtttcgggcgagtacacctggttcaatcacgacataaccagcgcttctat
gccatcaaggtgctgaagaaagcgcaagtggtgaagatgaagcaggtcgagcatacgaat
gatgaacgaaaaatgctgcagcgggttaagcatccattcctaattacgttgtggggcacg
ttccaggatgtgaagaatctttatatggttatggattttgtggagggtggggagctgttt
agtttactgaggaaatcgcagcgcttcccaaatcctgttgcgaaattctacgctgcggag
gttacgttggcgttggaatatctacatgaccatcacattgtatacagagacctaaagcca
gagaatctacttttagatcgatatggacatttgaagattacagattttggattcgcgaag
gaagtcaaggatattacatggactttatgcgggacaccagattatctggcgccggaggta
gtttcgtcaaagggatacaatatgtccgttgactggtggtccctcggcatcctaatcttc
gaaatgctctgcggcttcacccccttctgggacggcggcagccccatgaaaatctacgaa
aacatcataaaatgccgagtcaagtacccgtcctacatgcacccggacgcccaagatcta
ctctcccaactcatcactcccgatctcacagttcgcctgggaaacttgcacggcggcagt
caggatgttaagaatcatccgtggtttgcggaggtgacgtgggatcggctagcgcggaag
gatattgatgcgccgtatattccgccggtgaagggagggcagggggatgcaagccagttt
gataggtatcccgaggagacggagccgtatgggggcagtggggatgatccgtatggaaat
tatttcgtggacttttga

DBGET integrated database retrieval system