KEGG   Paracoccidioides brasiliensis: PAAG_00151Help
Entry
PAAG_00151        CDS       T02230                                 

Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_00151
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PAAG_00151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
MASPWMSSEAINGIYIPSALLICGTAIVKKEWLPYAAALAVILSGWQVFSNRQRKVLNPN
EFQNFVLKEKTIVSHNVAIYRFALPRPTDILGLPIGQHISLAATIEGQTKEIMRSYTPIS
SDQETGYFDLLVKAYPQGNISKHLAGLRIGQTMKVRGPKGAMVYTPNMAKKIGMIAGGTG
ITPMLQIIKAIIRGRQRNGGNDTTQVDLIFANVNPDDILLREELDQIAKEDDGFRIYYVL
NNPPAGWEGGVGFVTPDMIKAKLPAPAPDTKILICGPPPMVSAMKKATESLGFKKAGLVS
KLDDQVFCF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtccctggatgtcgagcgaagccatcaatgggatatatatcccttccgccctt
ctgatctgcggcactgccattgtgaagaaggaatggcttccttacgcggcggctcttgcg
gtgatactgtcgggctggcaggtgtttagcaacagacaaaggaaagttctcaaccccaac
gaattccaaaacttcgttttgaaagagaaaaccattgtctctcacaatgtcgccatctat
cgttttgcccttccgcggcccacagatatcctcggcttacccattggccaacacatttct
ctcgccgcgacaattgaaggccagacgaaggagattatgcgatcctatacccccatttcc
tcggatcaggaaaccggctacttcgaccttctcgtcaaggcatatcctcaggggaacatc
tctaagcaccttgctggcttgcgcatcgggcagaccatgaaggttcggggtcccaagggt
gccatggtttacactcccaatatggctaaaaagattggtatgatcgctggtggtacgggc
atcaccccgatgcttcagatcatcaaggctattatccgaggacgacagcggaatggaggc
aatgacactacacaggttgatctcatctttgccaacgttaacccggacgacatcctcctt
agggaagaattggatcagattgccaaggaggacgatggattccgcatctactacgtcttg
aacaaccctccagcgggctgggaaggtggtgttggctttgttactcccgatatgatcaag
gccaaactgcccgcacccgcacccgatacgaaaattttgatttgcggaccccctcctatg
gtcagtgcgatgaagaaagccaccgagtcccttggattcaagaaggccgggcttgtgagc
aagctggatgaccaggtcttttgcttctag

DBGET integrated database retrieval system