KEGG   Paracoccidioides brasiliensis: PAAG_00295Help
Entry
PAAG_00295        CDS       T02230                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAAG_00295
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAAG_00295
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAAG_00295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 783 aa AA seqDB search
MACIHLDSPELRAPRINQPVYREDCTQCFDSIDDPSGLDVCLFCFNGGCTGDRNHSSIHH
KRSGHPLVLNIKRTRKIVQMSKLAITAETEEDRYDTTTTVNCHSCQVSDIDKSAGNLPSV
VDGVMKALTFSRQEEVKAWEQEYSPCKHVLSLVQHGSIQENSNDFSKCASCNLKENLWLC
LECGNLGCGRSQFGGVGGNSHGLAHADSSSHGVAVKLGSITPEGSADVFCYKCNDEIIDP
NLATHLAHWGINVAERQKTEQSLVEMQIEQNLKWDFSMTGQDGHESKPLFGKGLTGLKNL
GNSCYISSAVQCLFSLPEFKERYFQSMTEPPPAVAPAEDLETQLRKLSDGIHSGRYSFPD
PDVAISAHSADVVYQKGLAPAMFKHLVGRGHEEFSTMRQQDAFEFLLHLFKLITRSKHTD
GLQDPVGSFRFALEQRLQCLVCKKVRYTVDEQDNISVPVPARRVKPSNSAVDGTEDRNSS
DKPEFETVTLKECLGIFTGEEIVELTCPACGSNDGFLKRSRFKTFPRNLAINARRFSLVN
WVPTKLNIPVEVDDKPVDLSSYMSPGFQEGEEQLPDNPPSEPTAFAPNQAALNQLLAMGF
PDVRCKKALHATGNSDAEAAMTWLFAHMEDPDIDVPVELTTSNATSVDHPMDDPDKIAQL
NEMGIDSAKARKALRETDGNVMRAVDWVFSHPDDFGAVETPPGDAASNEPPGSKYLPAEF
QLQSIICHKGASVHAGHYVAFVRKLLPGSETPQWVLFNDEKVVEANDVEEMKQFAYVYIF
RRL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcattcatcttgattccccagagcttcgtgccccgcggatcaaccaaccagtc
tatcgagaagattgcacgcagtgttttgactcaattgatgacccatctggcttggatgtg
tgtcttttctgtttcaatgggggttgtactggggacagaaatcactctagcatccaccat
aaacggtccggacatccattggtgttgaatatcaagagaaccaggaagatagtacagatg
tcgaagctagcgatcactgcggaaacagaagaagatcgctatgataccaccacaacggtc
aactgtcattcttgtcaagttagtgatattgacaagtctgccggaaatctcccttccgtt
gttgacggtgtaatgaaggcactcacattttctcgtcaggaggaagtgaaggcgtgggag
caggaatattccccttgtaagcatgtgctgtcgctggtgcagcatggctcaatccaggag
aattccaatgatttttctaagtgcgcctcgtgcaacttaaaagagaacctatggttgtgc
ctcgagtgtggtaatcttggatgtggccgaagccagtttggcggcgtgggtggtaattcc
cacggacttgctcatgcggatagttcttcccatggcgtcgctgtaaagcttggttctatt
acacccgaaggctctgcggatgttttctgttacaaatgtaatgacgagataatcgatcca
aatcttgctacacaccttgcgcactgggggataaacgttgctgagcgacaaaaaaccgag
caaagccttgttgaaatgcagattgaacaaaatcttaaatgggatttttcaatgactggt
caggatgggcatgagtcgaaacccctttttggaaagggacttactggactcaagaattta
ggaaacagctgttatatttccagcgctgttcagtgtcttttctcgttacctgagtttaag
gagcggtacttccaatccatgacagaaccaccgcctgccgttgcacctgccgaggaccta
gaaactcaattgcgaaaactcagtgatggtattcactctggccgctattcatttcccgac
ccagatgttgcgatttcggctcattctgcagacgttgtctatcaaaaaggacttgcacct
gcaatgttcaaacatttggttggccgtggtcacgaggaattttcaactatgcgccagcaa
gatgcatttgaatttcttctgcatctcttcaaactcattactcgttcaaaacacacagat
ggcctccaagatcccgtgggctcctttcgatttgcacttgagcagcgcttacaatgccta
gtatgcaaaaaggtccgatacacagtagatgaacaggataatatatcagtccctgttccc
gcacgtcgtgtaaaacctagcaatagtgcagtagatggaaccgaagatcggaattcttca
gataaaccagagttcgagacggttactctgaaggagtgcttgggcatttttacaggggaa
gagattgttgaactaacatgtccagcatgtggcagcaatgatggcttcctcaaacgatca
cgctttaagactttcccgaggaatttggctattaacgctcgccgtttcagtctagtcaac
tgggtgccaacaaaacttaatatccctgttgaggttgatgataaaccggtcgacttaagc
tcgtacatgtcccccgggtttcaggaaggtgaagaacaattgcctgacaatcctccgagt
gagccaacggcgtttgctccaaatcaagctgcacttaatcagctcctagcgatgggtttc
ccagatgttcggtgcaagaaggctcttcatgcaacgggaaactctgatgcagaggctgcc
atgacttggttatttgcccatatggaagatccagatattgatgttcctgtagaacttacc
accagcaatgctacctctgtcgatcacccaatggatgacccagacaaaatcgctcagcta
aatgaaatgggaattgactctgccaaggctcgtaaggctcttagagaaacggatgggaat
gttatgagagctgtcgattgggttttcagccaccctgatgattttggggcggttgagacc
ccacctggtgacgcagcctccaatgaacctccagggtctaaatatttgccagctgagttt
cagttacaatccattatctgccataaaggagcttcagttcatgccggacactatgttgcc
tttgtacgaaagctgcttccgggatcggaaacgccacagtgggttcttttcaacgatgag
aaggttgttgaggcaaacgacgttgaggagatgaagcagttcgcatatgtctacattttc
agacgattatag

DBGET integrated database retrieval system