KEGG   Paracoccidioides brasiliensis: PAAG_00299Help
Entry
PAAG_00299        CDS       T02230                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAAG_00299
Enzymes [BR:pbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PAAG_00299
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAAG_00299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 378 aa AA seqDB search
MSFSSLVSDLAFRGSLSDDRSSLTSNGLRSQQTPPRSYVSTAATSVSISGDISSQLHAGY
SHPLNRAWQAERQLTKSMLIYPLFITDNPDEETPIPSLPNQRRHGINRIVPLLTPLVQKG
LRSVILFGVPLAPSAKDALGTAADDPNGPVIQAIRVIRSQFPELYIIADVCLCEYTSHGH
CGILREDGSLNNALSVDRISDVALAYADAGAHCVAPSDMNDGRVRAIKLKLIDAGIAHRV
LLMSYSAKFSGCLYGPFRDAAGSCPSFGDRKCYQLPPGGRGLARRAIQRDIAEGADIIMV
KPAGTYLDIISDARELGKDMPVAAYQVSGEYAMIHAGAKAGVFDLKLMVMESMEGILRAG
ARIVVSYFVPELLDWLST
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcctcactagtttctgatcttgcctttagaggtagcctttccgacgaccgc
agctctttaacctccaatggcctgagatctcaacaaacgccccctcgatcatacgttagc
actgcggcaactagcgtgagcatatcgggagacatctccagccagctccatgcaggttac
agccatcctttgaacagagcatggcaggctgaacggcagctaactaagtccatgctcatc
tatcccctcttcatcaccgacaatccagacgaagaaaccccgatcccctccctccccaac
cagcgccgccacggcattaaccgtatcgtcccacttcttacccctctagtccaaaaagga
ctccgatctgtcattctctttggcgtccctctcgctcccagcgcaaaggatgccctagga
acagccgcagacgaccccaacggccccgtcatccaagccattcgcgtaatccgctcacaa
ttcccggaactctacataatcgccgacgtctgcctctgcgaatacacctcgcacggccac
tgtggtatcctccgcgaagacggctctctcaacaacgctctctccgtcgaccgcatctcc
gacgtcgccctcgcctatgccgacgcaggagcccactgcgtcgccccctcagacatgaac
gacggccgcgtgcgtgccataaaactcaaactcatcgatgcagggatcgcccatcgcgtc
ctcctgatgtcctatagcgccaaatttagcggctgcttatatgggcccttccgcgatgcg
gcgggttcctgtccttccttcggggaccggaagtgctaccaattgccaccgggtggtcgc
gggctggcccgccgcgccatccagcgtgatattgctgagggtgcggatatcattatggtc
aagcctgccggcacctacctggatatcattagtgatgctagggagctcggtaaagatatg
cctgtggcggcgtatcaggtgagcggggagtatgccatgatccatgctggggcgaaggcc
ggagtctttgatttgaagttgatggtgatggagagtatggagggtattctgagagctggg
gcgaggattgtggtgagttattttgtgccagagttgttggactggctttccacttga

DBGET integrated database retrieval system