KEGG   Paracoccidioides lutzii Pb01: PAAG_00316Help
Entry
PAAG_00316        CDS       T02230                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAAG_00316
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PAAG_00316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 203 aa AA seqDB search
MEETPTAAVRKFRPVVISGPSGTGKSTLIKRLFADYPDTFALSVSHTTRSPRPGEQDGRE
YYFTTKDAFKSLIDERGFIEWAQFSGNYYGTSTKAVKDVAEKKRICVLDIEMEGVKQVKR
TDLNARFLFVAPPSLKVLEQRLRGRGTETEESLQARLEQARKELEFAKEPGVHDLVIVND
ELEAAYGALREWVVDGGRFGDGD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaccccaacagcagcagtacgcaagttccgccccgtagtaatatcaggaccg
tccggcacgggcaaatcaactctgataaaaagactcttcgctgattacccagacacattt
gccctttcagtttctcatacaacccgctctccacgccccggcgaacaagatggccgcgaa
tactacttcacaacaaaagatgccttcaaatccctcatcgacgaaaggggctttatagaa
tgggcccagttcagcgggaactactacggtaccagcactaaggccgtaaaagacgtagcg
gagaagaagcgcatttgcgtcctggatattgagatggagggtgtcaaacaagtaaaacgc
acagatctaaacgcgcgcttcctcttcgttgcgccgccctcgctgaaggtactggagcag
cgcctccgtggccgcgggacggagacggaggagagtcttcaggcgcgcctggagcaggcg
cggaaggagctggagttcgcgaaagagccgggcgttcatgatttagttattgttaatgat
gagttggaggccgcatatggggcgttgagggagtgggtggttgatggggggaggtttggg
gatggggattga

DBGET integrated database retrieval system