KEGG   Paracoccidioides brasiliensis: PAAG_00339Help
Entry
PAAG_00339        CDS       T02230                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
pbl  Paracoccidioides brasiliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAAG_00339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MALFGTATSTTAVSNTAGDLSKDVALNSPPEDSISDLAFSSVSDHLAVASWDKKVRIYEI
NEQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGVDKAARMLDLQANATSPVQVAAHDAP
IRCCAMIQNPGNSSQPLLVTGSWDKTVKFWDLRQSTPIGTLECQERVYTMDVKNKLLVIG
TADRYINIVNLDQPTKFYKTMQSPLKYQTRVVSCFTDATGFAMGSIEGRCAIQYVEDKDS
SSNFSFKCHRESPSNTRDVSNVYSVNSIAFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGY
PAVGGTISSSAFNKTGNIFAYAVSYDWSKGYTNNTPQTPNKVMMHPVVPEEVRPRPGARR
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttttcggcacggcaacatccaccacggcggtctccaacaccgccggagacctc
tcgaaagatgtagctctcaactccccccccgaagacagtatttccgatcttgccttctcg
tcggtgagcgatcatcttgccgttgcctcatgggataagaaagttcgcatatacgagatc
aacgagcagggccagagtgagggcaaggccctttttgaacatgaagcaccagtcttgaac
tgctgctggtcgcctgatggcaccaaggtcgttggtgccggtgtcgacaaagctgcgcgc
atgctcgacctccaggcaaacgcaacatctcccgtccaagtggccgcccacgacgccccc
atcagatgctgtgccatgatacaaaacccaggaaactcctcccaacccctcctagtaaca
ggttcatgggacaaaaccgtcaaattctgggacttgcgccaatcgacaccaatcggcacg
ctcgaatgtcaagaacgggtctataccatggacgtgaaaaacaagctcctagtaatcggc
acagcagaccgctacatcaacatcgtcaacctcgaccagcccacgaagttctacaagaca
atgcagtcgccgctgaaataccagacgcgcgtcgtgagctgtttcactgacgcgacaggg
tttgccatgggcagtatcgagggccgctgcgccattcagtacgtcgaggataaagactct
agctcgaactttagcttcaagtgccaccgtgagagtccttccaatacgcgggatgttagt
aatgtctactctgtcaactcaatcgcgtttcatcctgtgcatggtacctttagcacggcc
ggcagtgatggcacgtttcacttctgggataaggacgccaaacatagacttaagggctat
ccggctgtgggagggacgatttcgagttccgcgttcaacaagacagggaatatttttgcg
tatgccgttagctacgattggagtaaagggtatacgaataatacgccacagactcctaat
aaggttatgatgcatcccgtcgtgccggaggaggtcaggccgcgtcctggcgcgaggcgg
agatga

DBGET integrated database retrieval system