KEGG   Paracoccidioides brasiliensis: PAAG_00416Help
Entry
PAAG_00416        CDS       T02230                                 

Definition
elongator complex protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_00416
Transfer RNA biogenesis [BR:pbl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PAAG_00416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 583 aa AA seqDB search
MATQTMTALPTKQLQKPQKTAKLPPENERYLRACSDIANALIQEYESQRDSTKPKKDINL
NKLRGQISKKHRLSTQPPLTAIISAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHR
CPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVEQIKSL
GHSVDKVEYIIMGGTFMSLPEDYRDEFISQLHNALSGYQTSNVDEAVQAGEMSNIKCVGI
TIETRPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVKAVVETFKLSKDAG
FKVVSHMMPDLPNVGMERDLDQFREYFENPDFRTDGLKIYPTLVIRGTGLYELWRTGRYK
NYTPNALVDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALSRMKDFGTTC
RDVRTREVGINEVKNKIRPSQVELVRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSK
THTFRPELTGQQTSLVRELHVYGSAVPLHGRDPRKFQHRGFGTLLMEEAERIAREEHGSR
KISVISGVGVRSYYARLGYWLDGPYMSKMLDPVERQDSGGEEC
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcagaccatgactgcgcttcccaccaagcagctgcagaaaccccagaagacg
gcaaagttgcctccagagaacgaacggtacctgagagcatgttcggatattgcaaatgcc
cttatccaagaatatgaatctcagagagactccaccaagccgaagaaggacatcaatctg
aacaagctgcggggtcaaatatcgaaaaagcaccgtctgagcacccaacccccactaaca
gctatcatctctgctgtcccggagcattataagaaatatatcctcccaaaactgattgcg
aagccgataagaacatcgtccggcattgccgtggtggcggtaatgtgcaaaccacatcga
tgccctcatattgcctacacgggaaatatttgcgtctactgccctggtggccctgactct
gatttcgaatactctacacaatcatataccggatatgaacccacgtccatgcgcgccatc
agagctcgatacgatcccttcgagcaagcaaggggcagagtggaacaaatcaaatcattg
ggacacagtgtggataaagtggaatacattatcatgggcggcactttcatgtccctgcca
gaggactatcgggacgaatttatatcacagctccacaatgcgcttagcggttatcagacc
agcaatgtcgacgaggccgtccaggccggggaaatgagtaacataaaatgtgtagggatc
accatcgaaacacgaccagattactgtctagacacccacctaagtagcatgctccggtac
ggctgcacacgcctcgagatcggcgtgcaaagtctctacgaagacgtcgcccgcgacacc
aacaggggtcacaccgtaaaagccgtagttgaaacattcaaactatccaaagacgccggc
ttcaaagtcgtcagccacatgatgcccgacctcccaaacgttggcatggaacgtgacctc
gaccaattccgagaatacttcgagaaccccgacttccgcaccgacggcctaaaaatatac
cccaccctcgtcatccgcggcacaggcctgtacgaactctggcgcacaggccgctataaa
aactacacgccaaacgccctcgtagacatcgtcgcacgcatcctcgccctcgtcccgccc
tggaccagaatctaccgcgtccagcgcgacatccccatgcccctcgtcacctccggcgtc
gagaacggcaaccttcgcgaactcgcgctgagccgcatgaaggacttcggcaccacgtgc
cgcgacgtgcgcacgcgtgaagtcggcatcaacgaggtgaagaacaaaattcgcccgtca
caagtcgagcttgtacggcgcgattacaccgccaatggtggctgggagacgtttttggcg
tacgaggatccgaagcaggatatccttattggcttgctgcggttgcgcaagtgtagcaag
acgcatacgttccggccggagctgacggggcagcagactagccttgtgcgtgagttgcat
gtgtacggctctgctgtgccgttgcatgggcgggatccgcgcaagtttcagcataggggg
tttggcacgctgttgatggaggaggcggagaggattgcgagggaggagcatgggagtcgg
aagatcagtgttatttctggcgttggggttaggagttattatgccagacttggatattgg
cttgatggaccgtatatgagtaagatgcttgatccggtggagcggcaagattctggcggt
gaggagtgctaa

DBGET integrated database retrieval system