KEGG   Paracoccidioides brasiliensis: PAAG_00535Help
Entry
PAAG_00535        CDS       T02230                                 

Definition
mitogen-activated protein kinase HOG1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAAG_00535
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAAG_00535
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PAAG_00535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MAEFVRAQIFGTTFEITNSSAKDQLTGQAVAVKKIMKPFSTPVLAKRTYRELKLLKHLRH
ENIISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQYFLYQILRGLKYVHSAG
VVHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDIEVD
VWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVIETICSVNTLQFVQSLPKR
PRQPLSNKFQNADPLAISLLERMLVFDPKKRITASESLSHEYLSPYHDPTDEPVADEKFD
WSFNDADLPVDTWKIMMYSEILDYHNVDQLMQDPNNQLPLDAAAGDVVSHSMLNVLKREK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtttgttcgcgctcagatttttggcaccactttcgagatcacaaacagctca
gcaaaggatcaattgaccgggcaggccgttgccgtgaagaagatcatgaagccctttagc
acccccgttctcgcaaagcgaacatacagagaattaaaactgctcaagcatttgcgacat
gaaaatattatcagtttgagcgacattttcatctcacccctcgaggatatatactttgtt
acagaacttcttgggacagatctacatagattgctcacctcacggccacttgaaaaacaa
ttcatccaatacttcttgtaccagatcttgcgaggactgaaatacgttcactccgcaggc
gtggtccaccgggacctcaagccaagtaacattctcattaatgagaattgcgaccttaag
atctgcgattttggccttgcccgtattcaagatccccaaatgaccggctacgtatcgacg
cgatactaccgtgcgcctgaaattatgcttacctggcaaaaatatgatattgaggtggat
gtgtggagcgctggatgcatctttgcagagatgctggaaggcaaacctctgttcccggga
aaggaccacgtgaatcaattttctattatcacggagctgctgggaactcctccagatgat
gtgattgaaaccatctgcagtgtcaacacattgcagtttgtccagtccctgcccaagcgg
ccgagacagcccctgagcaacaaattccagaacgcagaccctcttgccatcagcctcctc
gagcggatgctggttttcgatccgaagaaacgaatcactgccagcgagtccctttcacac
gaatacctctccccctaccacgacccaaccgacgagccagtagccgacgagaaattcgac
tggtcttttaacgatgccgacttaccagttgatacgtggaaaatcatgatgtactctgaa
atccttgactaccacaacgttgaccagctaatgcaagatcctaacaaccaactgcctctc
gatgctgctgccggggatgtggtatcgcatagtatgctgaatgtgctgaaacgagagaaa
taa

DBGET integrated database retrieval system