KEGG   Paracoccidioides brasiliensis: PAAG_00695Help
Entry
PAAG_00695        CDS       T02230                                 

Definition
serine/threonine-protein kinase PAK 2
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PAAG_00695
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAAG_00695
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: Other group
  TTK family
   PAAG_00695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 892 aa AA seqDB search
MAATATSTPLQTALPYGNSFQHPASRLQQLPRSTTSRSLSNHASPNTVTAAPTFNTGLFQ
MSRPRSFSIGDSSDDDIPEPIKFSASVKALLGEEDGSNIDTSQHTGGCINKSPNEGISVN
SEQHRALLIRKPQERQVRIASPRERDLGSPPPRVVRVNSPRLSQSGLGRDSPQLVRKDKN
SSDGQQQQHHHHHHHHHHHHHGNDFITPAAPQTRVVRVTDSRRNSRSPSTVSSIVTRSSE
KSSKEGGSRLGDRSFSGDERRRDENVYRSGSVNVLRPHPGEETGMQSSLRVKRVGRLTGS
FLNGPARRGMIRRQSEEVHQEEPVYESPTSNVSPRFNGEKHQQQQQQQQQQQPREFEPLR
NREQFIEKSQQYPRPSENLSGSPLPIQAPKRLPDPEIPADDAFLRSSTPKPSRSKSRSPL
SLELKGSSRSTKEVPAFYQVPPFPPRPASRNQENDPPPTFKRSKSQGFGLLDKAEKFSVV
YADEKEPVKPVQTILTPRRPLAPKDNNTPHRPAPPPPKMSVLETATAPAGANSSQARRKR
VQVTINRKPFTRLDCIGRGGSSKVYRVMAENCKIFALKRVNLEDVDPIAMAGYKGEIDLL
KRLENVDRVVRLFDYEVNEEKQALSVLMEIGESDLYRILTLRLNAEDAVFDTAFTRYYWK
EMLECVQAVHEFGIVHSDLKPANFVLVKGSLKLIDFGIANKIQDDTVNVHREQQIGTPNY
MAPESLIDINATNGLPSTVGKMMKVGKPSDVWSLGCILYQMVYGKPPFAHITKPLERIMA
IPNPNVIIEYPAYGVGGVPVPPGLIKTLKRCLQRDQTLRPTVQELLAQRDPFLYPEANLE
GAVPMTQEMLGRILTNVVNHCRARGPPKDEELAGWPAGFFGKIRSALEEDAL
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacggccacctcaaccccactccaaactgctttgccatacggcaacagcttc
caacacccggcgtcgcgacttcaacagctacctcgatcaacaacctctcgatccctttcc
aaccatgcatcgccaaatacagttacagcagcacccacatttaacactggtctattccag
atgtcaaggccacgatccttttccattggagacagctccgacgacgatattcccgaaccc
attaaatttagcgcatccgtcaaggcacttctgggagaggaagacggatcgaacattgac
acctcccagcacactggaggctgcataaataagtcgccaaatgaaggcataagcgtaaat
agcgaacaacaccgggctttgctaattcgaaaaccacaagagagacaagtacggattgcg
tcgccaagggaacgtgatctgggaagcccacctcctagggtcgtgagggtgaattcgcct
cgactttcacaaagcggcttaggtagagacagtccccaattggtgcggaaggacaaaaat
tcgtccgatggccaacaacaacaacatcatcatcatcatcatcatcatcatcatcatcat
catggtaatgatttcattacccctgctgcccctcaaaccagagtggtgcgggttacggat
tctaggaggaactcccgttccccatctacagtgtcttccattgtcactaggtcgagtgaa
aagtcatccaaggaaggtgggagtcgtctcggggaccgttcgttttctggtgatgaacgt
cgacgcgatgaaaacgtgtatcgatccggttctgttaatgtgcttcgaccacatcctggt
gaagagacgggaatgcaaagctcattacgagtcaaaagagttggtagattgacggggtcg
tttcttaatggaccggcccgtcgtggtatgattaggaggcagagcgaggaagttcatcag
gaggagccagtatacgaatcgccgacttcgaatgtcagtcctcggtttaatggagaaaag
catcaacagcaacaacaacaacaacaacaacaacaaccaagagaatttgaacctctccgt
aatcgtgagcaatttattgaaaaatctcaacaataccccagaccctcagaaaatctcagt
ggctcaccacttcccatacaagcgccaaaacgactacctgatccagagataccagccgac
gacgcgtttttaagatccagcacgccgaaaccgtcacgttcaaaatcgagatctcctcta
tcattagaactgaagggatcatcgcgatccacgaaagaagtaccagctttctatcaagtg
cctcctttcccacccaggcctgccagccgaaatcaagagaatgacccacctccaactttc
aaaagatccaaatctcagggcttcggtctccttgataaggcggaaaagttctctgttgta
tacgctgatgagaaggagccagttaagccggtgcaaacaattctcactccccgtaggcct
ctagcccccaaggataacaacactccccatagaccggccccaccccctccaaaaatgagc
gttttggaaacagcaactgcacccgcaggagccaactcatcccaggctcgacggaaacgt
gtacaggttaccatcaatcgcaagccttttaccagattagactgcatcgggcgaggcggt
agctccaaagtatatcgtgttatggctgagaattgtaaaatattcgcattaaaacgagtc
aatttggaagacgttgaccccattgcaatggctgggtacaagggagagattgatttgctt
aagaggctcgaaaatgtggatcgggtggtgcgactttttgattatgaggtgaatgaggaa
aaacaggcgctcagcgtcctgatggaaattggcgagtcagatctttacagaatccttact
cttcgtctcaatgcggaggacgcggtgtttgacactgcgtttacgagatattactggaaa
gaaatgctcgagtgtgttcaagccgttcacgagtttggcattgttcattcggatctcaaa
cctgcaaattttgtcctggtcaagggaagcctcaaactcattgactttggcattgcaaat
aagatccaagatgataccgtcaacgtccaccgcgagcaacaaatcggtacgccaaactac
atggctcccgagtctctgatcgacatcaacgccacaaacggcctgccatccaccgttgga
aagatgatgaaagtcggcaaaccgagcgatgtctggagtctaggctgcatcctttaccaa
atggtctacggcaaaccaccctttgcacatatcaccaagccgctcgaacgcataatggcc
attccaaatcccaacgtcattatcgaataccctgcttacggtgttggtggtgtccctgtg
ccgccgggactcatcaagacgctgaaacgctgcctgcagcgggatcaaactctccgaccg
acggtacaggaattgttggctcagcgagatcctttcctgtatcccgaagccaatttggag
ggcgccgtgcccatgacgcaggagatgttggggaggatcttgacgaatgttgtcaaccac
tgtagggctagaggcccgccgaaggatgaagaattggctgggtggccggctgggtttttt
gggaagataagatctgcacttgaagaggatgcgctctga

DBGET integrated database retrieval system