KEGG   Paracoccidioides lutzii Pb01: PAAG_00730Help
Entry
PAAG_00730        CDS       T02230                                 

Definition
(RefSeq) clathrin heavy chain 1
  KO
K04646  
clathrin heavy chain
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PAAG_00730
Membrane trafficking [BR:pbl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    PAAG_00730
Exosome [BR:pbl04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAAG_00730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1698 aa AA seqDB search
MANPTDIPIKFTELLQLQSIGVLENAIGSDSCTLESDHFVCVRQQTGNQQQIVVVNPHNP
AEVNRRSIPGDNAIMHWNKHVIAVRLATGNLRVINLQNEQVIKDVIFRREILFWKWISER
TLALVTGDRIYHWDVFEEKSQPIEASTLREPIKKDGEFDESKKWQITHYRTTEDQNWSAL
VAIQRKEDNSITGKIQLYSRTHQNSQVIEGQAAAFGTIRVEGNPMETKIFTFAVRSAIGA
KLHIVEIDNQNPSKKFSKKAVDLFFPPEAVLDFPTAIQVSKRYDIAYIVTKFGFIHLYDL
ETGNCLFLSRISSKPIFVTVPDSDSAGLVGVNRHGQVLAVSVDENKIIPYILEKLNNPGL
AVRLASKGGLPGADDLLKRQFDTLVAQGQYTEAAKVAANSPRGFLRTPATINILKNAPQP
STGMSVILQYFGMLLDQGGMNQYESVELVRPVLQQGRKHLLEKWMAENKLGCSEELGDMV
RPHDMNLALNIYLKANVPHKVVAGFAETGQFDKILAYSKQAGYQPDYIQLLQHIVRVNPE
KCAEFAAQLASDENGALVDLDRVVDVFISQNMIQQATAFLLDALKDNKPEHAHLQTRLLE
MNLVNAPQVADAILGNEMFTHYDKGRISQLCENAQLYQRALENTDDPTIIMRNIVRTDKL
NPEWLMNYFGRLSVDQCLECMNEMLKVNLRQNLSAVVQIATKFSDLLGPTNLINLLEKYR
TAEGLYYYLGSIVNLSEDPDVHFKYIEAATKMNQLTEVERICRESNYYNPEKVKNFLKEA
RLTEQLPLIIVCDRFNFIHDLVLYLYQSQQYKSIEVYVQRVNPSRTPAVVGGLLDVDCDE
SVIKNLLASVDAASIPIDDLVSEVESRNRLKILLPFLENTLAMGNQQQAVYNALAKIYID
SNNNPEKFLKENDLYDTLTVGKYCEKRDPNLAYVAYSKGQNDLELINITNENSMYRAQAR
YLLDRADPEIWAFVLNVNNIHRRSLVDQVIATAVPESAEPDKVSVAVKAFLDADLPGELI
ELLEKIILEPSPFSDNSSLQNLLMLTAAKADKGRLMDYIHKLSEFNADEIATMCISVGLY
EEAFEIYKKVDSHLAATNVLVDSIVSIDRAQEYAERVELPEVWSKVAKAQLDGLRVSDSI
ASYIRAGDPSNYNEVIETATHAGKDEDLVEFLKMARKTLREPAVDTALAFAYARLDQLSE
LEDFLHGINVADVEASGDKAYEEGFHQAAKIFYTSISNWAKLATTLVHLEEYQAAVECAR
KANNAKVWKQVSEACVSKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIAVLEA
GLGLERAHMGMFTELGIALSKYHPDRVMEHLKLFWTRINIPKMIRACEEANLWPELVFLY
CHYDEWDNAALAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQA
LTPRIDVNRVVRMFEKSDNIPLIKPFLLNVQPQNKKAVNNAINDLLIEEEDYKTLRDSVE
NYDNYDPVELAQRLEKHDLVFFRQIAASIYRKNKRWEKSISLSKQDKLFKDAIETAAISG
KTDVVEELLRYFVDIGSRECYVGMLYACYDLIRPDVVMEISWRYNLNDFSMPYMINLLSQ
QVRTIEMLKKDNEERKAREASQQKEEDNTPVLGGSRLMLTQGPASATGSGLGVQPSVSPI
PFGHANGITPQPTGFRPF
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcccacagacatccccatcaagttcacggaacttttacagttgcaatccatc
ggcgttttggagaatgcaattggttctgattcatgcaccctagagtccgatcacttcgtc
tgtgtacggcaacagaccggcaatcaacaacaaatcgtcgttgttaacccccacaatcca
gctgaagtcaaccgtcgttcgatcccgggcgacaatgccattatgcactggaataaacat
gtcatcgccgtcaggctggcaactggaaatcttcgggttatcaacctccagaacgaacag
gtcatcaaggacgtcatatttaggcgtgagattctgttctggaaatggattagtgaacga
actcttgccctagtgaccggagaccgcatctaccactgggacgtcttcgaggaaaagagc
cagcctattgaagcgtctactttgagggagccaattaagaaagacggtgaattcgatgaa
agcaagaaatggcaaatcacccactaccgaacaacagaggaccagaactggtcggcactt
gttgccatccaaagaaaagaagacaattccattactgggaagattcagctatattcccgt
acgcaccagaattctcaggtaatcgaaggacaggctgctgccttcggcaccattcgagtc
gaagggaatccaatggagacaaagattttcacattcgccgttcgatctgcgattggtgcg
aaattacacattgtggaaattgacaatcagaatcctagcaagaaattttccaagaaagct
gtggacctcttctttccgccggaagccgtactagatttccccactgcgattcaggtttct
aaaagatatgatattgcatacatcgtgaccaagtttggattcattcatctctacgacctg
gaaaccggcaactgtctgttcctgagcagaatttcttctaagccgatattcgtcacagtt
cccgattcggattcggccggtctcgtgggtgtcaaccgtcatggacaagttcttgccgtt
agtgtcgatgaaaataagataatcccgtacatcctagaaaagttgaacaatccggggctt
gctgtgagactcgcctcgaaggggggacttcctggcgccgacgacctccttaagagacaa
tttgacacgttggtagcacagggacagtatacagaagctgccaaagtcgctgccaattct
ccccgcgggttccttcgtacccctgcaacgattaatatcctcaagaatgctccacagcct
tcaaccggcatgtctgttatcttgcaatactttggaatgctccttgatcaaggtgggatg
aatcaatatgagagtgtggaactcgtgagaccggtactgcaacaaggtcgaaagcatctg
ttggagaagtggatggccgaaaacaagcttggttgctcagaggagcttggtgatatggtc
cgcccgcatgatatgaatcttgctctgaacatttacctcaaggccaatgtaccacataag
gttgttgctgggtttgccgaaaccggtcaattcgacaaaattttggcctattcgaagcaa
gccggttaccaaccagactacatccagcttcttcaacatatcgtgcgcgttaaccctgag
aagtgtgcagagttcgctgcacagcttgccagcgacgaaaatggtgcccttgttgacttg
gatcgcgttgttgacgtgttcatctcccagaacatgatccagcaagccactgcttttctt
ctcgatgccctaaaagacaacaagcctgagcatgcccatctccaaacgagattgctggag
atgaaccttgtcaacgctccgcaggtggcagacgctattcttggcaatgagatgtttaca
cactatgacaagggaaggatatcgcagctttgcgaaaatgcgcaactctaccaacgtgcg
ctggagaatactgatgatcctactattatcatgagaaatatcgtccgcactgacaaattg
aaccctgaatggttaatgaactacttcggacgtctatcagttgaccagtgtttggagtgc
atgaatgaaatgctgaaggttaaccttcgtcaaaatctgtcagctgtcgtccagattgcc
acgaagttttcggatctcctgggaccaactaacctgatcaatctcctggagaagtaccga
actgctgaaggtctttactattaccttggcagtattgtaaatctcagcgaggatcctgat
gttcatttcaaatatatcgaggccgcgaccaagatgaaccagctgactgaagtagagcgt
atctgccgggaaagcaactactacaacccggagaaggtcaagaatttcttgaaggaagct
cgcctcacggaacagttgcccttaatcatcgtctgcgaccgtttcaacttcattcatgac
cttgtactctatctttaccaaagccagcaatataagtccatcgaggtctacgttcagcgg
gtgaatccatcaagaaccccagccgtcgttggcggtctgttggatgttgattgcgacgag
agcgtcatcaaaaaccttctggctagcgttgacgcggcctcgatccccatcgatgacctt
gtttctgaggttgagtcccgaaaccgtcttaagattcttctcccattcctagagaataca
cttgccatgggcaaccagcaacaggcagtttacaatgccctcgctaagatttacatcgat
agtaataacaacccagaaaagtttttgaaggagaacgatctctacgatactcttaccgtt
ggaaagtactgtgagaagcgcgatcccaacctcgcctatgttgcatatagcaagggtcag
aatgatcttgagcttattaatatcaccaacgagaactctatgtaccgagcgcaagctcga
taccttttggaccgtgctgaccctgaaatctgggcgtttgtccttaacgtcaataacatc
caccgccgctctttggtcgaccaggtcattgccactgctgtgcccgagtctgccgagcca
gataaggtgtccgttgccgttaaggctttcctcgatgctgatttgcctggagaactcatt
gagcttttggaaaagatcattttggagccatcacctttcagcgataacagcagtttgcaa
aatctgttgatgcttactgctgccaaagccgataagggtcgtctgatggattacatccat
aaactttctgagttcaatgcagatgaaattgcgactatgtgtatttctgtagggttgtat
gaggaggcttttgaaatctacaagaaggttgatagtcatctggctgctactaatgtcctt
gttgattccatcgttagcatcgatcgtgcacaggaatatgcggagcgtgttgaacttcct
gaagtttggagcaaggttgctaaggctcagttggatggtcttcgtgtctctgattcaatt
gcttcatacatccgtgcaggtgacccatcgaattacaatgaagtcatcgaaacagccact
cacgccggcaaggacgaggatctcgtcgagtttctcaaaatggctcggaaaaccttgcgg
gaaccagcagttgatactgccttggcttttgcctatgctagactggatcagctaagtgaa
ctcgaggatttcctgcacggtattaacgtggcagacgtcgaagcatctggtgacaaggca
tacgaggaaggtttccaccaagctgccaagatcttctataccagcatctccaactgggcg
aaacttgcaaccacccttgtccatctggaagaatatcaggctgctgtcgagtgcgcgcgg
aaagcaaacaacgccaaagtctggaagcaagtcagcgaggcctgcgtgtctaagaaggaa
tttcgcctcgctcagatttgcggtctcaatctcatcgtccacgcggaggaattgcaggat
ttggttcgccaatacgagcgcaatggttatttcgatgagcttattgctgtcttggaagcc
gggcttggtctggagcgagcgcacatgggcatgttcacggaactgggtattgcactttcc
aagtaccatcctgacagagtaatggaacatctgaaactcttctggacgcgaatcaacatc
ccgaagatgatccgagcctgcgaggaggcaaacctatggcctgagctggtgttcttgtac
tgccactatgatgaatgggataatgctgcgctcgccatgatggagcgtgcagcagatgcc
tgggaacaccattctttcaaggatatcatagtcaaggtcgccaatctggaaatttactac
cgcgcactgaacttttacctgcaggaacaacctctgctgctgacggatctgctccaagcc
cttacgccacgcattgatgtcaaccgcgtcgtgcgcatgtttgagaaatctgataatatc
cccttgatcaaaccattcttgctcaacgtgcaaccacagaacaagaaagcagtcaacaat
gctattaatgatttgttgattgaagaggaggactataagacattgcgggattcggttgag
aattatgataattatgatcctgtcgaacttgctcagagacttgagaagcatgacctggtc
tttttcagacagattgccgctagcatctacaggaagaacaagcggtgggagaagtcgatt
tccttgtcgaagcaggataagcttttcaaggatgctattgagactgctgctatttctggc
aagaccgatgttgtcgaggagttgctacgatacttcgtcgatattggcagccgagaatgc
tacgttggcatgctttacgcctgctatgatctaatccgtcccgatgtcgtcatggaaatc
tcctggcgctacaacctcaacgacttttccatgccatacatgattaacctgctcagccag
caagtgcgcacaatcgagatgctcaagaaggataatgaggagcgcaaagcccgcgaagct
tcccagcaaaaggaagaagacaatacgcctgtcctcggtggatcgagacttatgcttacg
cagggccccgcatcggcaacgggctctgggcttggggtgcagccgtctgtcagtcctatt
ccgttcggacatgcgaatgggattacaccgcagccaaccggattcagaccgttttga

DBGET integrated database retrieval system