KEGG   Paracoccidioides brasiliensis: PAAG_00730Help
Entry
PAAG_00730        CDS       T02230                                 

Definition
clathrin heavy chain 1
Orthology
K04646  
clathrin heavy chain
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PAAG_00730
Exosome [BR:pbl04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAAG_00730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1649 aa AA seqDB search
MANPTDIPIKFTELLQLQSIGVLENAIGSDSCTLESDHFVCVRQQTGNQQQIVVVNPHNP
AEVNRRSIPGDNAIMHWNKHVIAVRLATGNLRVINLQNEQVIKDVIFRREILFWKWISER
TLALVTGDRIYHWDVFEEKSQPIEASTLREPIKKDGEFDESKNWSALVAIQRKEDNSITG
KIQLYSRTHQNSQVIEGQAAAFGTIRVEGNPMETKIFTFAVRSAIGAKLHIVEIDNQNPS
KKFSKKAVDLFFPPEAVLDFPTAIQVSKRYDIAYIVTKFGFIHLYDLETGNCLFLSRISS
KPIFVTVPDSDSAGLVGVNRHGQVLAVSVDENKIIPYILEKLNNPGLAVRLASKGGLPGA
DDLLKRQFDTLVAQGQYTEAAKVAANSPRGFLRTPATINILKNAPQPSTGMSVILQYFGM
LLDQGGMNQYESVELVRPVLQQGRKHLLEKWMAENKLGCSEELGDMVRPHDMNLALNIYL
KANVPHKVVAGFAETGQFDKILAYSKQAGYQPDYIQLLQHINMIQQATAFLLDALKDNKP
EHAHLQTRLLEMNLVNAPQVADAILGNEMFTHYDKGRISQLCENAQLYQRALENTDDPTI
IMRNIVRTDKLNPEWLMNYFGRLSVDQCLECMNEMLKVNLRQNLSAVVQIATKFSDLLGP
TNLINLLEKYRTAEGLYYYLGSIVNLSEDPDVHFKYIEAATKMNQLTEVERICRESNYYN
PEKVKNFLKEARLTEQLPLIIVCDRFNFIHDLVLYLYQSQQYKSIEVYVQRVNPSRTPAV
VGGLLDVDCDESVIKNLLASVDAASIPIDDLVSEVESRNRLKILLPFLENTLAMGNQQQA
VYNALAKIYIDSNNNPEKFLKENDLYDTLTVGKYCEKRDPNLAYVAYSKGQNDLELINIT
NENSMYRAQARYLLDRADPEIWAFVLNVNNIHRRSLVDQVIATAVPESAEPDKVSVAVKA
FLDADLPGELIELLEKIILEPSPFSDNSSLQNLLMLTAAKADKGRLMDYIHKLSEFNADE
IATMCISVGLYEEAFEIYKKVDSHLAATNVLVDSIVSIDRAQEYAERVELPEVWSKVAKA
QLDGLRVSDSIASYIRAGDPSNYNEVIETATHAGKDEDLVEFLKMARKTLREPAVDTALA
FAYARLDQLSELEDFLHGINVADVEASGDKAYEEGFHQAAKIFYTSISNWAKLATTLVHL
EEYQAAVECARKANNAKVWKQVSEACVSKKEFRLAQICGLNLIVHAEELQDLVRQYERNG
YFDELIAVLEAGLGLERAHMGMFTELGIALSKYHPDRVMEHLKLFWTRINIPKMIRACEE
ANLWPELVFLYCHYDEWDNAALAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQE
QPLLLTDLLQALTPRIDVNRVVRMFEKSDNIPLIKPFLLNVQPQNKKAVNNAINDLLIEE
EDYKTLRDSVENYDNYDPVELAQRLEKHDLVFFRQIAASIYRKNKRWEKSISLSKQDKLF
KDAIETAAISGKTDVVEELLRYFVDIGSRECYVGMLYACYDLIRPDVVMEISWRYNLNDF
SMPYMINLLSQQVRTIEMLKKDNEERKAREASQQKEEDNTPVLGGSRLMLTQGPASATGS
GLGVQPSVSPIPFGHANGITPQPTGFRPF
NT seq 4950 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcccacagacatccccatcaagttcacggaacttttacagttgcaatccatc
ggcgttttggagaatgcaattggttctgattcatgcaccctagagtccgatcacttcgtc
tgtgtacggcaacagaccggcaatcaacaacaaatcgtcgttgttaacccccacaatcca
gctgaagtcaaccgtcgttcgatcccgggcgacaatgccattatgcactggaataaacat
gtcatcgccgtcaggctggcaactggaaatcttcgggttatcaacctccagaacgaacag
gtcatcaaggacgtcatatttaggcgtgagattctgttctggaaatggattagtgaacga
actcttgccctagtgaccggagaccgcatctaccactgggacgtcttcgaggaaaagagc
cagcctattgaagcgtctactttgagggagccaattaagaaagacggtgaattcgatgaa
agcaagaactggtcggcacttgttgccatccaaagaaaagaagacaattccattactggg
aagattcagctatattcccgtacgcaccagaattctcaggtaatcgaaggacaggctgct
gccttcggcaccattcgagtcgaagggaatccaatggagacaaagattttcacattcgcc
gttcgatctgcgattggtgcgaaattacacattgtggaaattgacaatcagaatcctagc
aagaaattttccaagaaagctgtggacctcttctttccgccggaagccgtactagatttc
cccactgcgattcaggtttctaaaagatatgatattgcatacatcgtgaccaagtttgga
ttcattcatctctacgacctggaaaccggcaactgtctgttcctgagcagaatttcttct
aagccgatattcgtcacagttcccgattcggattcggccggtctcgtgggtgtcaaccgt
catggacaagttcttgccgttagtgtcgatgaaaataagataatcccgtacatcctagaa
aagttgaacaatccggggcttgctgtgagactcgcctcgaaggggggacttcctggcgcc
gacgacctccttaagagacaatttgacacgttggtagcacagggacagtatacagaagct
gccaaagtcgctgccaattctccccgcgggttccttcgtacccctgcaacgattaatatc
ctcaagaatgctccacagccttcaaccggcatgtctgttatcttgcaatactttggaatg
ctccttgatcaaggtgggatgaatcaatatgagagtgtggaactcgtgagaccggtactg
caacaaggtcgaaagcatctgttggagaagtggatggccgaaaacaagcttggttgctca
gaggagcttggtgatatggtccgcccgcatgatatgaatcttgctctgaacatttacctc
aaggccaatgtaccacataaggttgttgctgggtttgccgaaaccggtcaattcgacaaa
attttggcctattcgaagcaagccggttaccaaccagactacatccagcttcttcaacat
atcaacatgatccagcaagccactgcttttcttctcgatgccctaaaagacaacaagcct
gagcatgcccatctccaaacgagattgctggagatgaaccttgtcaacgctccgcaggtg
gcagacgctattcttggcaatgagatgtttacacactatgacaagggaaggatatcgcag
ctttgcgaaaatgcgcaactctaccaacgtgcgctggagaatactgatgatcctactatt
atcatgagaaatatcgtccgcactgacaaattgaaccctgaatggttaatgaactacttc
ggacgtctatcagttgaccagtgtttggagtgcatgaatgaaatgctgaaggttaacctt
cgtcaaaatctgtcagctgtcgtccagattgccacgaagttttcggatctcctgggacca
actaacctgatcaatctcctggagaagtaccgaactgctgaaggtctttactattacctt
ggcagtattgtaaatctcagcgaggatcctgatgttcatttcaaatatatcgaggccgcg
accaagatgaaccagctgactgaagtagagcgtatctgccgggaaagcaactactacaac
ccggagaaggtcaagaatttcttgaaggaagctcgcctcacggaacagttgcccttaatc
atcgtctgcgaccgtttcaacttcattcatgaccttgtactctatctttaccaaagccag
caatataagtccatcgaggtctacgttcagcgggtgaatccatcaagaaccccagccgtc
gttggcggtctgttggatgttgattgcgacgagagcgtcatcaaaaaccttctggctagc
gttgacgcggcctcgatccccatcgatgaccttgtttctgaggttgagtcccgaaaccgt
cttaagattcttctcccattcctagagaatacacttgccatgggcaaccagcaacaggca
gtttacaatgccctcgctaagatttacatcgatagtaataacaacccagaaaagtttttg
aaggagaacgatctctacgatactcttaccgttggaaagtactgtgagaagcgcgatccc
aacctcgcctatgttgcatatagcaagggtcagaatgatcttgagcttattaatatcacc
aacgagaactctatgtaccgagcgcaagctcgataccttttggaccgtgctgaccctgaa
atctgggcgtttgtccttaacgtcaataacatccaccgccgctctttggtcgaccaggtc
attgccactgctgtgcccgagtctgccgagccagataaggtgtccgttgccgttaaggct
ttcctcgatgctgatttgcctggagaactcattgagcttttggaaaagatcattttggag
ccatcacctttcagcgataacagcagtttgcaaaatctgttgatgcttactgctgccaaa
gccgataagggtcgtctgatggattacatccataaactttctgagttcaatgcagatgaa
attgcgactatgtgtatttctgtagggttgtatgaggaggcttttgaaatctacaagaag
gttgatagtcatctggctgctactaatgtccttgttgattccatcgttagcatcgatcgt
gcacaggaatatgcggagcgtgttgaacttcctgaagtttggagcaaggttgctaaggct
cagttggatggtcttcgtgtctctgattcaattgcttcatacatccgtgcaggtgaccca
tcgaattacaatgaagtcatcgaaacagccactcacgccggcaaggacgaggatctcgtc
gagtttctcaaaatggctcggaaaaccttgcgggaaccagcagttgatactgccttggct
tttgcctatgctagactggatcagctaagtgaactcgaggatttcctgcacggtattaac
gtggcagacgtcgaagcatctggtgacaaggcatacgaggaaggtttccaccaagctgcc
aagatcttctataccagcatctccaactgggcgaaacttgcaaccacccttgtccatctg
gaagaatatcaggctgctgtcgagtgcgcgcggaaagcaaacaacgccaaagtctggaag
caagtcagcgaggcctgcgtgtctaagaaggaatttcgcctcgctcagatttgcggtctc
aatctcatcgtccacgcggaggaattgcaggatttggttcgccaatacgagcgcaatggt
tatttcgatgagcttattgctgtcttggaagccgggcttggtctggagcgagcgcacatg
ggcatgttcacggaactgggtattgcactttccaagtaccatcctgacagagtaatggaa
catctgaaactcttctggacgcgaatcaacatcccgaagatgatccgagcctgcgaggag
gcaaacctatggcctgagctggtgttcttgtactgccactatgatgaatgggataatgct
gcgctcgccatgatggagcgtgcagcagatgcctgggaacaccattctttcaaggatatc
atagtcaaggtcgccaatctggaaatttactaccgcgcactgaacttttacctgcaggaa
caacctctgctgctgacggatctgctccaagcccttacgccacgcattgatgtcaaccgc
gtcgtgcgcatgtttgagaaatctgataatatccccttgatcaaaccattcttgctcaac
gtgcaaccacagaacaagaaagcagtcaacaatgctattaatgatttgttgattgaagag
gaggactataagacattgcgggattcggttgagaattatgataattatgatcctgtcgaa
cttgctcagagacttgagaagcatgacctggtctttttcagacagattgccgctagcatc
tacaggaagaacaagcggtgggagaagtcgatttccttgtcgaagcaggataagcttttc
aaggatgctattgagactgctgctatttctggcaagaccgatgttgtcgaggagttgcta
cgatacttcgtcgatattggcagccgagaatgctacgttggcatgctttacgcctgctat
gatctaatccgtcccgatgtcgtcatggaaatctcctggcgctacaacctcaacgacttt
tccatgccatacatgattaacctgctcagccagcaagtgcgcacaatcgagatgctcaag
aaggataatgaggagcgcaaagcccgcgaagcttcccagcaaaaggaagaagacaatacg
cctgtcctcggtggatcgagacttatgcttacgcagggccccgcatcggcaacgggctct
gggcttggggtgcagccgtctgtcagtcctattccgttcggacatgcgaatgggattaca
ccgcagccaaccggattcagaccgttttga

DBGET integrated database retrieval system